Products

View as table Download

Rabbit Polyclonal Anti-NPTN Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NPTN antibody: synthetic peptide directed towards the middle region of human NPTN. Synthetic peptide located within the following region: MEYRINKPRAEDSGEYHCVYHFVSAPKANATIEVKAAPDITGHKRSENKN

Rabbit polyclonal anti-NPTN antibody

Applications IHC
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human NPTN.

Rabbit Polyclonal Anti-NPTN Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NPTN antibody: synthetic peptide directed towards the middle region of human NPTN. Synthetic peptide located within the following region: SAPKANATIEVKAAPDITGHKRSENKNEGQDATMYCKSVGYPHPDWIWRK

Carrier-free (BSA/glycerol-free) NPTN mouse monoclonal antibody, clone OTI3C4 (formerly 3C4)

Applications IF, IHC, WB
Reactivities Human, Monkey, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NPTN mouse monoclonal antibody, clone OTI2D4 (formerly 2D4)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NPTN mouse monoclonal antibody, clone OTI2A6 (formerly 2A6)

Applications IF, WB
Reactivities Human, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NPTN mouse monoclonal antibody, clone OTI2F4 (formerly 2F4)

Applications IF, WB
Reactivities Human, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NPTN mouse monoclonal antibody, clone OTI2F5 (formerly 2F5)

Applications IF, WB
Reactivities Human, Rat
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) NPTN mouse monoclonal antibody, clone OTI1E5 (formerly 1E5)

Applications IF, WB
Reactivities Human, Rat
Conjugation Unconjugated

NPTN mouse monoclonal antibody, clone OTI3C4 (formerly 3C4)

Applications IF, IHC, WB
Reactivities Human, Monkey, Rat, Dog
Conjugation Unconjugated

NPTN mouse monoclonal antibody, clone OTI3C4 (formerly 3C4)

Applications IF, IHC, WB
Reactivities Human, Monkey, Rat, Dog
Conjugation Unconjugated

NPTN mouse monoclonal antibody, clone OTI2D4 (formerly 2D4)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

NPTN mouse monoclonal antibody, clone OTI2D4 (formerly 2D4)

Applications IF, IHC, WB
Reactivities Human, Monkey, Mouse, Rat, Dog
Conjugation Unconjugated

NPTN mouse monoclonal antibody, clone OTI2A6 (formerly 2A6)

Applications IF, WB
Reactivities Human, Rat
Conjugation Unconjugated

NPTN mouse monoclonal antibody, clone OTI2A6 (formerly 2A6)

Applications IF, WB
Reactivities Human, Rat
Conjugation Unconjugated

NPTN mouse monoclonal antibody, clone OTI2F4 (formerly 2F4)

Applications IF, WB
Reactivities Human, Rat
Conjugation Unconjugated

NPTN mouse monoclonal antibody, clone OTI2F4 (formerly 2F4)

Applications IF, WB
Reactivities Human, Rat
Conjugation Unconjugated

NPTN mouse monoclonal antibody, clone OTI2F5 (formerly 2F5)

Applications IF, WB
Reactivities Human, Rat
Conjugation Unconjugated

NPTN mouse monoclonal antibody, clone OTI2F5 (formerly 2F5)

Applications IF, WB
Reactivities Human, Rat
Conjugation Unconjugated

NPTN mouse monoclonal antibody, clone OTI1E5 (formerly 1E5)

Applications IF, WB
Reactivities Human, Rat
Conjugation Unconjugated

NPTN mouse monoclonal antibody, clone OTI1E5 (formerly 1E5)

Applications IF, WB
Reactivities Human, Rat
Conjugation Unconjugated