Products

View as table Download

Rabbit Polyclonal Anti-IVD Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-IVD antibody is: synthetic peptide directed towards the N-terminal region of Human IVD. Synthetic peptide located within the following region: APKAQEIDRSNEFKNLREFWKQLGNLGVLGITAPVQYGGSGLGYLEHVLV

Rabbit Polyclonal antibody to IVD (isovaleryl Coenzyme A dehydrogenase)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 222 of IVD (Uniprot ID#P26440)

IVD rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human IVD

IVD rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human IVD

IVD Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 33-200 of human IVD (NP_002216.2).
Modifications Unmodified