Rabbit Polyclonal MFI2 Antibody
Applications | ELISA, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal MFI2 Antibody
Applications | ELISA, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal MFI2 Antibody
Applications | ELISA, WB |
Reactivities | Human, Monkey, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | DNA immunization. This antibody is specific for the N Terminus Region of the target protein. |
Rabbit Polyclonal Anti-MFI2 Antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-MFI2 antibody: synthetic peptide directed towards the C terminal of human MFI2. Synthetic peptide located within the following region: CVPVNNPKNYPSSLCALCVGDEQGRNKCVGNSQERYYGYRGAFRCLVENA |
MFI2 / Melanotransferrin Rabbit Polyclonal (N-Terminus) Antibody
Applications | IHC |
Reactivities | Gibbon, Dog, Gorilla, Horse, Human, Monkey, Mouse, Rabbit |
Conjugation | Unconjugated |
Immunogen | MFI2 / p97 / Melanotransferrin antibody was raised against synthetic 15 amino acid peptide from N-terminus of human MFI2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Marmoset, Mouse, Dog, Elephant, Panda, Horse, Rabbit (100%); Bovine, Hamster, Pig (93%); Rat, Turkey, Chicken, Platypus (87%). |
MELTF rabbit polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human MELTF |