Products

View as table Download

Rabbit Polyclonal TIRAP Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen TIRAP antibody was raised against a peptide corresponding to 15 amino acids near the C-terminus of mouse TIRAP.

Rabbit Polyclonal TIRAP Antibody

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen TIRAP antibody was raised against a peptide corresponding to amino acids near the middle of human TIRAP.

Goat Polyclonal Antibody against TIRAP (C-terminal)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-EGEGERDSATVSDL, from the C Terminus of the protein sequence according to NP_683708.1.

Goat Polyclonal Antibody against TIRAP (Internal Region)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-QTLLKKPKKRPNSPE, from the internal region of the protein sequence according to NP_001034750.1; NP_683708.1.

Rabbit Polyclonal Anti-TIRAP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-TIRAP antibody: synthetic peptide directed towards the middle region of human TIRAP. Synthetic peptide located within the following region: LEGSTASLRCFLQLRDATPGGAIVSELCQALSSSHCRVLLITPGFLQDPW

Rabbit Polyclonal Anti-TIRAP Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Full length fusion protein

TIRAP Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-221 of human TIRAP (NP_001034750.1).
Modifications Unmodified