Rabbit anti-HLA-A Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HLA-A |
Rabbit anti-HLA-A Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human HLA-A |
Rabbit Polyclonal Anti-HLA-A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HLA-A antibody is: synthetic peptide directed towards the N-terminal region of Human HLA-A. Synthetic peptide located within the following region: SDAASQRMEPRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQ |
Mouse monoclonal Anti-HLA-A2 Clone BB7.2
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HLA mouse monoclonal antibody, clone OTI4D11
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HLA mouse monoclonal antibody, clone OTI2D11
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) HLA mouse monoclonal antibody, clone OTI3H6
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
HLA mouse monoclonal antibody, clone OTI4D11
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
HLA mouse monoclonal antibody, clone OTI4D11
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
HLA mouse monoclonal antibody, clone OTI2D11
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
HLA mouse monoclonal antibody, clone OTI2D11
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
HLA mouse monoclonal antibody, clone OTI3H6
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
HLA mouse monoclonal antibody, clone OTI3H6
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |