Products

View as table Download

Rabbit Polyclonal Pyruvate Carboxylase Antibody

Applications IHC, WB
Reactivities Bovine, Human, Mouse, Porcine, Rat
Conjugation Unconjugated
Immunogen A genomic peptide made to an internal region of the human Pyruvate Carboxylase protein (within residues 930-1050). [Swiss-Prot P11498]

Rabbit polyclonal PC antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PC.

Goat Polyclonal Antibody against Pyruvate Carboxylase

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Peptide with sequence C-KFKEVKKAYVEANQ, from the internal region of the protein sequence according to NP_000911.2; NP_001035806.1; NP_071504.2.

Rabbit Polyclonal Anti-PC Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PC antibody: synthetic peptide directed towards the C terminal of human PC. Synthetic peptide located within the following region: SLPPLDLQALEKELVDRHGEEVTPEDVLSAAMYPDVFAHFKDFTATFGPL

Anti-PC Rabbit Polyclonal Antibody

Applications ELISA, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 563-832 amino acids of human pyruvate carboxylase

Anti-PC Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein corresponding to a region derived from 563-832 amino acids of human pyruvate carboxylase