Products

View as table Download

Goat Polyclonal Antibody against CRKL

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-KIFDPQNPDENE, from the C Terminus of the protein sequence according to NP_005198.

Rabbit monoclonal antibody against Phospho CrkL (pY207)(EP270Y) (phospho-specific)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Modifications Phospho-specific

Rabbit Polyclonal anti-CRKL Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CRKL antibody is: synthetic peptide directed towards the middle region of Human CRKL. Synthetic peptide located within the following region: RSSPHGKHGNRNSNSYGIPEPAHAYAQPQTTTPLPAVSGSPGAAITPLPS

Rabbit Polyclonal Anti-CRKL Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CRKL

CRKL rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide of human CRKL

CRKL Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic peptide of human CRKL
Modifications Unmodified

CRKL Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-303 of human CRKL (NP_005198.1).
Modifications Unmodified

Phospho-CRKL-Y207 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen A synthetic phosphorylated peptide around Y207 of human CRKL (NP_005198.1).
Modifications Phospho Y207

CrkL (phospho-Y207) polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic phosphopeptide derived from human CrkL around the phosphorylation site of Tyrosine 207.