Rabbit polyclonal anti-CPB2 antibody
Applications | WB |
Reactivities | Human (Identities = 100%, Positives = 100% |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CPB2. |
Rabbit polyclonal anti-CPB2 antibody
Applications | WB |
Reactivities | Human (Identities = 100%, Positives = 100% |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human CPB2. |
Rabbit Polyclonal Anti-CPB2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-CPB2 Antibody: synthetic peptide directed towards the middle region of human CPB2. Synthetic peptide located within the following region: RSKSKDHEELSLVASEAVRAIEKTSKNTRYTHGHGSETLYLAPGGGDDWI |
USD 465.00
In Stock
Carrier-free (BSA/glycerol-free) CPB2 mouse monoclonal antibody, clone OTI3D5 (formerly 3D5)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
CPB2 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human CPB2 |
CPB2 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 310-410 of human CPB2 (NP_001863.3). |
Modifications | Unmodified |
CPB2 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 115-365 of human CPB2 (NP_001863.2). |
Modifications | Unmodified |
USD 379.00
In Stock
CPB2 mouse monoclonal antibody, clone OTI3D5 (formerly 3D5)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
CPB2 mouse monoclonal antibody, clone OTI3D5 (formerly 3D5)
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |