Products

View as table Download

Rabbit polyclonal anti-CPB2 antibody

Applications WB
Reactivities Human (Identities = 100%, Positives = 100%
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human CPB2.

Rabbit Polyclonal Anti-CPB2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-CPB2 Antibody: synthetic peptide directed towards the middle region of human CPB2. Synthetic peptide located within the following region: RSKSKDHEELSLVASEAVRAIEKTSKNTRYTHGHGSETLYLAPGGGDDWI

Carrier-free (BSA/glycerol-free) CPB2 mouse monoclonal antibody, clone OTI3D5 (formerly 3D5)

Applications IHC
Reactivities Human
Conjugation Unconjugated

CPB2 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human CPB2

CPB2 Rabbit polyclonal Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 310-410 of human CPB2 (NP_001863.3).
Modifications Unmodified

CPB2 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 115-365 of human CPB2 (NP_001863.2).
Modifications Unmodified

CPB2 mouse monoclonal antibody, clone OTI3D5 (formerly 3D5)

Applications IHC
Reactivities Human
Conjugation Unconjugated