Products

Jump to Filters
View as table Download
GPRC5B Rabbit Polyclonal Antibody
TA315497

USD 345.00

4 Weeks

Rabbit polyclonal anti-GPRC5B antibody

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human GPRC5B.
GPRC5B Rabbit Polyclonal Antibody
TA342742

USD 375.00

5 Days

Rabbit Polyclonal Anti-GPRC5B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-GPRC5B antibody: synthetic peptide directed towards the N terminal of human GPRC5B. Synthetic peptide located within the following region: AVAGAGALITLLLMLILLVRLPFIKEKEKKSPVGLHFLFLLGTLGLFGLT
GPRC5B Rabbit Polyclonal Antibody
TA340928

USD 425.00

5 Days

Rabbit Polyclonal Anti-GPRC5B Antibody (C-Terminus)

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen RAIG2 / GPRC5B antibody was raised against synthetic 16 amino acid peptide from C-terminus of human GPRC5B. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset (100%); Mouse, Rat, Dog, Bovine, Elephant, Panda, Horse, Rabbit, Pig, Opossum, Turkey, Chicken, Xenopus, Pufferfish, Zebrafish, Stickleback (94%).