Products

Jump to Filters
View as table Download
GUCY1A2 Rabbit Polyclonal Antibody
TA337335

USD 375.00

5 Days

Rabbit Polyclonal Anti-GUCY1A2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-GUCY1A2 antibody is: synthetic peptide directed towards the N-terminal region of Human GUCY1A2. Synthetic peptide located within the following region: KNFHNISNRCSYADHSNKEEIEDVSGILQCTANILGLKFEEIQKRFGEEF