GUCY1A2 Rabbit Polyclonal Antibody

CAT#: TA337335

Rabbit Polyclonal Anti-GUCY1A2 Antibody

Product Images

Host: Rabbit; Target Name: GUCY1A2; Sample Tissue: HepG2 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml

Specifications

Product Data

• Applications: WB
• Recommended Dilution: WB
• Reactivities: Human
• Host: Rabbit
• Isotype: IgG
• Clonality: Polyclonal
• Immunogen: The immunogen for Anti-GUCY1A2 antibody is: synthetic peptide directed towards the N-terminal region of Human GUCY1A2. Synthetic peptide located within the following region: KNFHNISNRCSYADHSNKEEIEDVSGILQCTANILGLKFEEIQKRFGEEF
• Formulation: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
  Note that this product is shipped as lyophilized powder to China customers.
• Purification: Affinity Purified
• Conjugation: Unconjugated
• Storage: Store at -20°C as received.
• Stability: Stable for 12 months from date of receipt.
• Predicted Protein Size: 81 kDa
• Gene Name: guanylate cyclase 1, soluble, alpha 2
• Database Link:
  NP_001243353
  Entrez Gene 2977 Human
  UniProt ID P33402
• Background: Soluble guanylate cyclases are heterodimeric proteins that catalyze the conversion of GTP to 3',5'-cyclic GMP and pyrophosphate. The protein encoded by this gene is an alpha subunit of this complex and it interacts with a beta subunit to form the guanylate cyclase enzyme, which is activated by nitric oxide. Two transcript variants encoding different isoforms have been found for this gene.
• Synonyms: GC-SA2; GUC1A2
• Note: Immunogen Sequence Homology: Rat: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Zebrafish: 100%; Pig: 93%; Rabbit: 93%; Guinea pig: 93%; Bovine: 86%; Dog: 85%

Reference Data

• Protein Families: Druggable Genome
• Protein Pathways: Gap junction, Long-term depression, Purine metabolism, Vascular smooth muscle contraction