Products

View as table Download

IFNGR1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human IFNGR1

Rabbit anti-IFNGR1 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human IFNGR1

Rabbit Polyclonal Anti-IFNGR1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-IFNGR1 antibody is: synthetic peptide directed towards the C-terminal region of Human IFNGR1. Synthetic peptide located within the following region: EVDYDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVS

IFNGR1 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle terminal region of human IFNGR1

IFNGR1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide of human IFNGR1

Recombinant Anti-IFN-gamma receptor 1 (Clone GR20)

Applications Bl, FC, Neutralize
Reactivities Mouse
Conjugation Unconjugated
Modifications This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG2a format, for improved compatibility with existing reagents, assays and techniques.

Recombinant Anti-IFN-gamma receptor 1 (Clone GR20)

Applications Bl, FC, Neutralize
Reactivities Mouse
Conjugation Unconjugated