Germany
Japan
United Kingdom
China
IFNGR1 (Myc-DDK-tagged)-Human interferon gamma receptor 1 (IFNGR1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Ifngr1 (Myc-DDK-tagged) - Mouse interferon gamma receptor 1 (Ifngr1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Recombinant protein of human interferon gamma receptor 1 (IFNGR1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Lenti ORF particles, IFNGR1 (Myc-DDK tagged) - Human interferon gamma receptor 1 (IFNGR1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, IFNGR1 (mGFP-tagged) - Human interferon gamma receptor 1 (IFNGR1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Ifngr1 (GFP-tagged) - Mouse interferon gamma receptor 1 (Ifngr1), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
IFNGR1 (GFP-tagged) - Human interferon gamma receptor 1 (IFNGR1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Ifngr1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN508143 is the updated version of KN308143.
IFNGR1 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN402761 is the updated version of KN202761.
Lenti ORF clone of Ifngr1 (Myc-DDK-tagged) - Mouse interferon gamma receptor 1 (Ifngr1)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ifngr1 (Myc-DDK-tagged) - Mouse interferon gamma receptor 1 (Ifngr1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Ifngr1 (mGFP-tagged) - Mouse interferon gamma receptor 1 (Ifngr1)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ifngr1 (GFP-tagged) - Mouse interferon gamma receptor 1 (Ifngr1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human interferon gamma receptor 1 (IFNGR1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, IFNGR1 (Myc-DDK tagged) - Human interferon gamma receptor 1 (IFNGR1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, IFNGR1 (mGFP-tagged) - Human interferon gamma receptor 1 (IFNGR1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Ifngr1 (Myc-DDK-tagged ORF) - Rat interferon gamma receptor 1 (Ifngr1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Ifngr1 (Myc-DDK-tagged ORF) - Rat interferon gamma receptor 1 (Ifngr1), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ifngr1 (Myc-DDK-tagged ORF) - Rat interferon gamma receptor 1 (Ifngr1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Ifngr1 (mGFP-tagged ORF) - Rat interferon gamma receptor 1 (Ifngr1), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Ifngr1 (GFP-tagged ORF) - Rat interferon gamma receptor 1 (Ifngr1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
IFNGR1 (untagged)-Human interferon gamma receptor 1 (IFNGR1)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
qSTAR qPCR primer pairs against Homo sapiens gene IFNGR1
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Lenti ORF clone of Human interferon gamma receptor 1 (IFNGR1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF clone of Human interferon gamma receptor 1 (IFNGR1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
IFNGR1 (untagged)-Human interferon gamma receptor 1 (IFNGR1)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Rabbit anti-IFNGR1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human IFNGR1 |
IFNGR1 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
| E. coli Selection | Ampicillin |
| Mammalian Cell Selection | Puromycin |
Transient overexpression lysate of interferon gamma receptor 1 (IFNGR1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Lenti ORF clone of Human interferon gamma receptor 1 (IFNGR1), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Ifngr1 - Mouse, 4 unique 29mer shRNA constructs in retroviral RFP vector
| Format | Retroviral plasmids |
| Vector | pRFP-C-RS |
IFNGR1 - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | GFP-puro |
IFNGR1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
IFNGR1 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
IFNGR1 (C-term) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 460-489 amino acids from the C-terminal region of human IFNGR1 |
qSTAR qPCR primer pairs against Mus musculus gene Ifngr1
Rabbit Polyclonal Anti-IFNGR1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IFNGR1 antibody is: synthetic peptide directed towards the C-terminal region of Human IFNGR1. Synthetic peptide located within the following region: EVDYDPETTCYIRVYNVYVRMNGSEIQYKILTQKEDDCDEIQCQLAIPVS |
IFNGR1 CRISPRa kit - CRISPR gene activation of human interferon gamma receptor 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Ifngr1 CRISPRa kit - CRISPR gene activation of mouse interferon gamma receptor 1
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene IFNGR1
| Application | Plasmid of exact quantity for transcript copy number calculation |
IFNGR1 - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | mBFP-Neo |
IFNGR1 - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | Luciferase-Puro |
IFNGR1 - human gene knockout kit via CRISPR, HDR mediated
| Format | 2 gRNA vectors, 1 GFP-puro donor, 1 scramble control |
| Donor DNA | RFP-BSD |
Ifngr1 (untagged) - Mouse interferon gamma receptor 1 (Ifngr1), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
IFNGR1 MS Standard C13 and N15-labeled recombinant protein (NP_000407)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
Ifngr1 (untagged ORF) - Rat interferon gamma receptor 1 (Ifngr1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of interferon gamma receptor 1 (IFNGR1) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
Ifngr1 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Active filters
Target Symbol
- IFNGR1