Products

Jump to Filters
View as table Download
Cytokeratin 3 (KRT3) Rabbit Polyclonal Antibody
TA342732

USD 375.00

5 Days

Rabbit Polyclonal Anti-KRT3 Antibody

Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-KRT3 antibody: synthetic peptide directed towards the C terminal of human KRT3. Synthetic peptide located within the following region: GSSGFSGGSGFGSISGARYGVSGGGFSSASNRGGSIKFSQSSQSSQRYSR
Cytokeratin 3 (KRT3) Rabbit Polyclonal Antibody
TA377912

USD 220.00

3 Weeks

KRT3 Rabbit polyclonal Antibody

Applications IF, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 230-390 of human KRT3 (NP_476429.2).
Modifications Unmodified