Germany
Japan
United Kingdom
China
KRT3 (Myc-DDK-tagged)-Human keratin 3 (KRT3). Note: ORF is codon optimized
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Products
View as table DownloadLenti-ORF clone of KRT3 (Myc-DDK-tagged)-Human keratin 3 (KRT3). Note: ORF is codon optimized
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 880.00
6 Weeks
Lenti ORF particles, KRT3 (Myc-DDK-tagged)-Human keratin 3 (KRT3), 200ul, >10^7 TU/mL. Note: ORF is codon optimized
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti-ORF clone of KRT3 (mGFP-tagged)-Human keratin 3 (KRT3). Note: ORF is codon optimized
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 880.00
6 Weeks
Lenti ORF particles, KRT3 (mGFP-tagged)-Human keratin 3 (KRT3), 200ul, >10^7 TU/mL. Note: ORF is codon optimized
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
KRT3 (GFP-tagged) - Human keratin 3 (KRT3). Note: ORF is codon optimized
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Cytokeratin 3 (KRT3) guinea pig polyclonal antibody, Serum
| Applications | IF, IHC |
| Reactivities | Human, Mouse |
| Immunogen | Synthetic peptide of Human keratin K3 (formerly also designated cytokeratin 3; C- IKF SQS SQS SQR YSR), coupled to KLH |
Cytokeratin 3 (KRT3) mouse monoclonal antibody, clone AE5, Purified
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Rabbit |
Purified recombinant protein of Human keratin 3 (KRT3), full length, with N-terminal HIS tag, expressed in E. coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
Cytokeratin 3 (KRT3) (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 413-441 amino acids from the Central region of human KRT3 |
Rabbit Polyclonal Anti-KRT3 Antibody
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-KRT3 antibody: synthetic peptide directed towards the C terminal of human KRT3. Synthetic peptide located within the following region: GSSGFSGGSGFGSISGARYGVSGGGFSSASNRGGSIKFSQSSQSSQRYSR |
KRT3 CRISPRa kit - CRISPR gene activation of human keratin 3
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qSTAR qPCR primer pairs against Homo sapiens gene KRT3
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
KRT3 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
KRT3 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 230-390 of human KRT3 (NP_476429.2). |
| Modifications | Unmodified |
Transient overexpression of KRT3 (NM_057088) in HEK293T cells paraffin embedded controls for ICC/IHC staining
KRT3 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
KRT3 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
KRT3 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
| E. coli Selection | Ampicillin |
| Mammalian Cell Selection | Puromycin |
Transient overexpression of KRT3 (NM_057088) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of KRT3 (NM_057088) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- KRT3