Products

View as table Download

Rabbit anti-NDRG1 Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human NDRG1

Goat Polyclonal Antibody against NDRG1

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence GNSAGPKSMEVSC, from the C Terminus of the protein sequence according to NP_006087.2.

Rabbit Polyclonal Anti-NDRG1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NDRG1 antibody: synthetic peptide directed towards the C terminal of human NDRG1. Synthetic peptide located within the following region: GSSVTSLDGTRSRSHTSEGTRSRSHTSEGTRSRSHTSEGAHLDITPNSGA

Rabbit Polyclonal Anti-NDRG1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-NDRG1 antibody: synthetic peptide directed towards the N terminal of human NDRG1. Synthetic peptide located within the following region: MSREMQDVDLAEVKPLVEKGETITGLLQEFDVQEQDIETLHGSVHVTLCG

Anti-NDRG1 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 381-394 amino acids of human N-myc downstream regulated 1

NDRG1 Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human NDRG1

NDRG1 Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse NDRG1

Phospho-NDRG1-T346 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic phosphorylated peptide around T346 of human NDRG1 (NP_001128714.1).
Modifications Phospho T346

Phospho-NDRG1-S330 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen A synthetic phosphorylated peptide around S330 of human NDRG1 (NP_001128714.1).
Modifications Phospho S330