Rabbit Polyclonal Anti-NMNAT1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-NMNAT1 antibody: synthetic peptide directed towards the N terminal of human NMNAT1. Synthetic peptide located within the following region: PVGDAYKKKGLIPAYHRVIMAELATKNSKWVEVDTWESLQKEWKETLKVL |
NMNAT1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-150 of human NMNAT1 (NP_073624.2). |
| Modifications | Unmodified |
NMNAT1 mouse monoclonal antibody, clone OTI1F7 (formerly 1F7)
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
NMNAT1 mouse monoclonal antibody, clone OTI1G4 (formerly 1G4)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: “NEURO15".
Germany
Japan
United Kingdom
China
