Products

View as table Download

Phosphodiesterase 1c / PDE1C Rabbit Polyclonal (C-Terminus) Antibody

Applications IHC
Reactivities Bat, Bovine, Hamster, Human, Monkey, Mouse, Orang-Utan, Rabbit, Rat, Gorilla, Dog, Horse, Gibbon
Conjugation Unconjugated
Immunogen PDE1C antibody was raised against synthetic 16 amino acid peptide from C-terminus of human PDE1C. Percent identity with other species by BLAST analysis: Human, Gorilla, Orangutan, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Bat, Hamster, Elephant, Panda, Horse, Rabbit (100%); Opossum (88%).

Rabbit Polyclonal Anti-PDE1C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PDE1C Antibody: synthetic peptide directed towards the N terminal of human PDE1C. Synthetic peptide located within the following region: DLKKNIEYAASVLEAVYIDETRRLLDTEDELSDIQTDSVPSEVRDWLAST

Rabbit polyclonal Anti-PDE1C Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDE1C antibody: synthetic peptide directed towards the middle region of human PDE1C. Synthetic peptide located within the following region: IDFIVEPTFTVLTDMTEKIVSPLIDETSQTGGTGQRRSSLNSISSSDAKR

PDE1C Antibody - C-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the C-terminal region of Human PDE1C

PDE1C Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 435-634 of human PDE1C (NP_001177985.1).
Modifications Unmodified