Products

Jump to Filters
View as table Download
Proteasome subunit beta type 4 (PSMB4) Rabbit Polyclonal Antibody
TA332850

USD 275.00

3 Weeks

Rabbit anti-PSMB4 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PSMB4
Proteasome subunit beta type 4 (PSMB4) Rabbit Polyclonal Antibody
TA342167

USD 375.00

5 Days

Rabbit polyclonal Anti-PSMB4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSMB4 antibody: synthetic peptide directed towards the middle region of human PSMB4. Synthetic peptide located within the following region: YLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMV
Proteasome subunit beta type 4 (PSMB4) Rabbit Polyclonal Antibody
TA342168

USD 375.00

5 Days

Rabbit polyclonal Anti-PSMB4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSMB4 antibody: synthetic peptide directed towards the middle region of human PSMB4. Synthetic peptide located within the following region: SRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQ
Proteasome subunit beta type 4 (PSMB4) Mouse Monoclonal Antibody [Clone ID: OTI5B5]
CF503480

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PSMB4 mouse monoclonal antibody, clone OTI5B5 (formerly 5B5)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Proteasome subunit beta type 4 (PSMB4) Mouse Monoclonal Antibody [Clone ID: OTI2C9]
CF503558

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PSMB4 mouse monoclonal antibody, clone OTI2C9 (formerly 2C9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PSMB4 Rabbit Polyclonal Antibody
TA365758

USD 380.00

4 Weeks

PSMB4 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PSMB4
PSMB4 Rabbit Polyclonal Antibody
TA370096

USD 380.00

4 Weeks

PSMB4 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PSMB4
Proteasome subunit beta type 4 (PSMB4) Mouse Monoclonal Antibody [Clone ID: OTI5B5]
TA503480

USD 379.00

In Stock

PSMB4 (Proteasome subunit beta type 4 ) mouse monoclonal antibody, clone OTI5B5 (formerly 5B5)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Proteasome subunit beta type 4 (PSMB4) Mouse Monoclonal Antibody [Clone ID: OTI5B5]
TA503480S

USD 159.00

2 Days

PSMB4 (Proteasome subunit beta type 4 ) mouse monoclonal antibody, clone OTI5B5 (formerly 5B5)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Proteasome subunit beta type 4 (PSMB4) Mouse Monoclonal Antibody [Clone ID: OTI2C9]
TA503558

USD 379.00

In Stock

PSMB4 (Proteasome subunit beta type 4 ) mouse monoclonal antibody, clone OTI2C9 (formerly 2C9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Proteasome subunit beta type 4 (PSMB4) Mouse Monoclonal Antibody [Clone ID: OTI2C9]
TA503558S

USD 159.00

2 Days

PSMB4 (Proteasome subunit beta type 4 ) mouse monoclonal antibody, clone OTI2C9 (formerly 2C9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated