Products

Antibodies (40)
cDNA Clones (22)
RNAi (12)
Proteins (10)
Gene Expression (7)
Jump to Filters
View as table Download
Psmb4 (NM_008945) Mouse Tagged ORF Clone
MR203487

USD 68.00

USD 219.00

In Stock

Psmb4 (Myc-DDK-tagged) - Mouse proteasome (prosome, macropain) subunit, beta type 4 (Psmb4)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Psmb4 Mouse Gene Knockout Kit (CRISPR)
KN514102

USD 1,290.00

2 Weeks

Psmb4 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN514102 is the updated version of KN314102.
Psmb4 (NM_008945) Mouse Tagged ORF Clone
MG203487

USD 300.00

3 Weeks

Psmb4 (GFP-tagged) - Mouse proteasome (prosome, macropain) subunit, beta type 4 (Psmb4)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Psmb4 (NM_008945) Mouse Tagged ORF Clone
MR203487L3

USD 500.00

3 Weeks

Lenti ORF clone of Psmb4 (Myc-DDK-tagged) - Mouse proteasome (prosome, macropain) subunit, beta type 4 (Psmb4)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Psmb4 (NM_008945) Mouse Tagged ORF Clone Lentiviral Particle
MR203487L3V

USD 700.00

6 Weeks

Lenti ORF particles, Psmb4 (Myc-DDK-tagged) - Mouse proteasome (prosome, macropain) subunit, beta type 4 (Psmb4), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Psmb4 (NM_008945) Mouse Tagged ORF Clone
MR203487L4

USD 500.00

3 Weeks

Lenti ORF clone of Psmb4 (mGFP-tagged) - Mouse proteasome (prosome, macropain) subunit, beta type 4 (Psmb4)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Psmb4 (NM_008945) Mouse Tagged ORF Clone Lentiviral Particle
MR203487L4V

USD 700.00

6 Weeks

Lenti ORF particles, Psmb4 (GFP-tagged) - Mouse proteasome (prosome, macropain) subunit, beta type 4 (Psmb4), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Proteasome subunit beta type 4 (PSMB4) (NM_002796) Human Tagged ORF Clone Lentiviral Particle
RC205723L3V

USD 820.00

6 Weeks

Lenti ORF particles, PSMB4 (Myc-DDK tagged) - Human proteasome (prosome, macropain) subunit, beta type, 4 (PSMB4), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Proteasome subunit beta type 4 (PSMB4) (NM_002796) Human Tagged ORF Clone Lentiviral Particle
RC205723L4V

USD 820.00

6 Weeks

Lenti ORF particles, PSMB4 (mGFP-tagged) - Human proteasome (prosome, macropain) subunit, beta type, 4 (PSMB4), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Psmb4 (NM_031629) Rat Tagged ORF Clone
RR213808

USD 420.00

4 Weeks

Psmb4 (Myc-DDK-tagged ORF) - Rat proteasome (prosome, macropain) subunit, beta type 4 (Psmb4), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Psmb4 (NM_031629) Rat Tagged ORF Clone
RR213808L3

USD 640.00

8 Weeks

Lenti ORF clone of Psmb4 (Myc-DDK-tagged ORF) - Rat proteasome (prosome, macropain) subunit, beta type 4 (Psmb4), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Psmb4 (NM_031629) Rat Tagged ORF Clone Lentiviral Particle
RR213808L3V

USD 850.00

12 Weeks

Lenti ORF particles, Psmb4 (Myc-DDK-tagged ORF) - Rat proteasome (prosome, macropain) subunit, beta type 4 (Psmb4), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Psmb4 (NM_031629) Rat Tagged ORF Clone
RR213808L4

USD 700.00

8 Weeks

Lenti ORF clone of Psmb4 (mGFP-tagged ORF) - Rat proteasome (prosome, macropain) subunit, beta type 4 (Psmb4), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Psmb4 (NM_031629) Rat Tagged ORF Clone Lentiviral Particle
RR213808L4V

USD 960.00

12 Weeks

Lenti ORF particles, Psmb4 (GFP-tagged ORF) - Rat proteasome (prosome, macropain) subunit, beta type 4 (Psmb4), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Proteasome subunit beta type 4 (PSMB4) Rabbit Polyclonal Antibody
TA332850

USD 275.00

3 Weeks

Rabbit anti-PSMB4 Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PSMB4
Psmb4 (NM_008945) Mouse Untagged Clone
MC200276

USD 210.00

In Stock

Psmb4 (untagged) - Mouse proteasome (prosome, macropain) subunit, beta type 4 (Psmb4), (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
Proteasome subunit beta type 4 (PSMB4) Rabbit Polyclonal Antibody
TA342167

USD 375.00

5 Days

Rabbit polyclonal Anti-PSMB4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSMB4 antibody: synthetic peptide directed towards the middle region of human PSMB4. Synthetic peptide located within the following region: YLKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMV
Proteasome subunit beta type 4 (PSMB4) Rabbit Polyclonal Antibody
TA342168

USD 375.00

5 Days

Rabbit polyclonal Anti-PSMB4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PSMB4 antibody: synthetic peptide directed towards the middle region of human PSMB4. Synthetic peptide located within the following region: SRRSKMNPLWNTMVIGGYADGESFLGYVDMLGVAYEAPSLATGYGAYLAQ
PSMB4 Human shRNA Plasmid Kit (Locus ID 5692)
TL310111

USD 815.00

2 Weeks

PSMB4 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
E. coli Selection Chloramphenicol
Mammalian Cell Selection Puromycin
PSMB4 / PROS26 (46-264, His-tag) Human Protein
AR50131PU-N

USD 1,105.00

2 Weeks

PSMB4 / PROS26 (46-264, His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli
PSMB4 / PROS26 (46-264, His-tag) Human Protein
AR50131PU-S

USD 415.00

2 Weeks

PSMB4 / PROS26 (46-264, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli
Proteasome subunit beta type 4 (PSMB4) Mouse Monoclonal Antibody [Clone ID: OTI5B5]
CF503480

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PSMB4 mouse monoclonal antibody, clone OTI5B5 (formerly 5B5)

Applications FC, IF, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Proteasome subunit beta type 4 (PSMB4) Mouse Monoclonal Antibody [Clone ID: OTI2C9]
CF503558

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PSMB4 mouse monoclonal antibody, clone OTI2C9 (formerly 2C9)

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Human Proteasome subunit beta type 4 (PSMB4) activation kit by CRISPRa
GA103861

USD 1,290.00

2 Weeks

PSMB4 CRISPRa kit - CRISPR gene activation of human proteasome subunit beta 4

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Mouse Psmb4 activation kit by CRISPRa
GA203426

USD 1,290.00

2 Weeks

Psmb4 CRISPRa kit - CRISPR gene activation of mouse proteasome (prosome, macropain) subunit, beta type 4

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector
Proteasome subunit beta type 4 (PSMB4) Human qPCR Template Standard (NM_002796)
HK205957

USD 330.00

5 Days

qPCR primer pairs and template standards against Homo sapiens gene PSMB4

Application Plasmid of exact quantity for transcript copy number calculation
Proteasome subunit beta type 4 (PSMB4) Human qPCR Primer Pair (NM_002796)
HP206421

USD 120.00

5 Days

qSTAR qPCR primer pairs against Homo sapiens gene PSMB4

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)
Psmb4 Mouse qPCR Template Standard (NM_008945)
MK200175

USD 330.00

5 Days

qPCR primer pairs and template standards against Mus musculus gene Psmb4

Application Plasmid of exact quantity for transcript copy number calculation
Psmb4 Mouse qPCR Primer Pair (NM_008945)
MP211893

USD 120.00

5 Days

qSTAR qPCR primer pairs against Mus musculus gene Psmb4

Psmb4 (NM_031629) Rat Untagged Clone
RN213808

USD 420.00

4 Weeks

Psmb4 (untagged ORF) - Rat proteasome (prosome, macropain) subunit, beta type 4 (Psmb4), (10 ug)

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
Proteasome subunit beta type 4 (PSMB4) (NM_002796) Human 3' UTR Clone
SC200727

USD 560.00

4 Weeks

3`UTR clone of proteasome (prosome macropain) subunit beta type 4 (PSMB4) for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase
PSMB4 Human siRNA Oligo Duplex (Locus ID 5692)
SR303827

USD 430.00

2 Weeks

PSMB4 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Psmb4 Mouse siRNA Oligo Duplex (Locus ID 19172)
SR407548

USD 430.00

2 Weeks

Psmb4 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Psmb4 Rat siRNA Oligo Duplex (Locus ID 58854)
SR513519

USD 430.00

2 Weeks

Psmb4 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

PSMB4 Rabbit Polyclonal Antibody
TA365758

USD 380.00

4 Weeks

PSMB4 rabbit polyclonal antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PSMB4