Products

View as table Download

Rabbit Polyclonal Anti-RNASE1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RNASE1 antibody: synthetic peptide directed towards the middle region of human RNASE1. Synthetic peptide located within the following region: MHITDCRLTNGSRYPNCAYRTSPKERHIIVACEGSPYVPVHFDASVEDST

Rabbit Polyclonal Anti-RNASE1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RNASE1 antibody: synthetic peptide directed towards the N terminal of human RNASE1. Synthetic peptide located within the following region: MALEKSLVRLLLLVLILLVLGWVQPSLGKESRAKKFQRQHMDSDSSPSSS

RNASE1 rabbit polyclonal antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human RNASE1

RNASE1 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human RNASE1

RNASE1 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 29-156 of human RNASE1 (NP_937875.1).
Modifications Unmodified