RNASE1 (Myc-DDK-tagged)-Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
RNASE1 (Myc-DDK-tagged)-Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
RNASE1 (Myc-DDK-tagged)-Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
RNASE1 (Myc-DDK-tagged)-Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
RNASE1 (Myc-DDK-tagged)-Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 820.00
3 Weeks
Lenti ORF particles, RNASE1 (Myc-DDK tagged) - Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, RNASE1 (mGFP-tagged) - Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Rnase1 (Myc-DDK-tagged) - Mouse ribonuclease, RNase A family, 1 (pancreatic) (Rnase1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
RNASE1 (GFP-tagged) - Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
RNASE1 (GFP-tagged) - Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Rnase1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Rnase1 (GFP-tagged) - Mouse ribonuclease, RNase A family, 1 (pancreatic) (Rnase1)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Rnase1 (Myc-DDK-tagged) - Mouse ribonuclease, RNase A family, 1 (pancreatic) (Rnase1)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Rnase1 (Myc-DDK-tagged) - Mouse ribonuclease, RNase A family, 1 (pancreatic) (Rnase1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Rnase1 (mGFP-tagged) - Mouse ribonuclease, RNase A family, 1 (pancreatic) (Rnase1)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Rnase1 (GFP-tagged) - Mouse ribonuclease, RNase A family, 1 (pancreatic) (Rnase1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 4, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
5 Weeks
Lenti ORF particles, RNASE1 (Myc-DDK tagged) - Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 4, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
7 Weeks
Lenti ORF particles, RNASE1 (mGFP-tagged) - Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 4, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, RNASE1 (Myc-DDK tagged) - Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, RNASE1 (mGFP-tagged) - Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 3, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, RNASE1 (Myc-DDK tagged) - Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 3, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, RNASE1 (mGFP-tagged) - Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, RNASE1 (Myc-DDK tagged) - Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
6 Weeks
Lenti ORF particles, RNASE1 (mGFP-tagged) - Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
RNASE1 (GFP-tagged) - Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
RNASE1 (GFP-tagged) - Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Rnase1 (Myc-DDK-tagged ORF) - Rat ribonuclease, RNase A family, 1 (pancreatic) (Rnase1), (10 ug)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Rnase1 (Myc-DDK-tagged ORF) - Rat ribonuclease, RNase A family, 1 (pancreatic) (Rnase1), (10 ug)
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Rnase1 (Myc-DDK-tagged ORF) - Rat ribonuclease, RNase A family, 1 (pancreatic) (Rnase1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Rnase1 (mGFP-tagged ORF) - Rat ribonuclease, RNase A family, 1 (pancreatic) (Rnase1), (10 ug)
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, Rnase1 (GFP-tagged ORF) - Rat ribonuclease, RNase A family, 1 (pancreatic) (Rnase1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 4, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
RNASE1 rabbit polyclonal antibody, Azide Free
Applications | ELISA, ID, IF, IP, R, WB |
Reactivities | Bovine |
Immunogen | Ribonuclease A isolated and purified from bovine pancreas. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
RNASE1 rabbit polyclonal antibody, Biotin
Applications | ELISA, ID, IF, IP, R, WB |
Reactivities | Bovine |
Conjugation | Biotin |
Immunogen | Ribonuclease A isolated and purified from bovine pancreas. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
RNASE1 rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, ID, IF, IP, R, WB |
Reactivities | Bovine |
Immunogen | Ribonuclease A isolated and purified from bovine pancreas. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
RNASE1 (untagged)-Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 4
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
RNASE1 (untagged)-Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 3
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-RNASE1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RNASE1 antibody: synthetic peptide directed towards the middle region of human RNASE1. Synthetic peptide located within the following region: MHITDCRLTNGSRYPNCAYRTSPKERHIIVACEGSPYVPVHFDASVEDST |
Rabbit Polyclonal Anti-RNASE1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-RNASE1 antibody: synthetic peptide directed towards the N terminal of human RNASE1. Synthetic peptide located within the following region: MALEKSLVRLLLLVLILLVLGWVQPSLGKESRAKKFQRQHMDSDSSPSSS |
RNASE1 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
Format | Lentiviral plasmids |
Vector | pGFP-C-shLenti |
E. coli Selection | Chloramphenicol |
Mammalian Cell Selection | Puromycin |
RNASE1 rabbit polyclonal antibody, Serum
Applications | ELISA, IP, WB |
Reactivities | Bovine |
Immunogen | Ribonuclease A [Bovine Pancreas]. |
RNASE1 rabbit polyclonal antibody, Biotin, Purified
Applications | ELISA, IP, WB |
Reactivities | Bovine |
Conjugation | Biotin |
Immunogen | Ribonuclease A from bovine pancreas |