Germany
Japan
United Kingdom
China
RNASE1 (Myc-DDK-tagged)-Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
RNASE1 (Myc-DDK-tagged)-Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 4
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
RNASE1 (Myc-DDK-tagged)-Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 3
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
RNASE1 (Myc-DDK-tagged)-Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Recombinant protein of human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 1
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
USD 820.00
3 Weeks
Lenti ORF particles, RNASE1 (Myc-DDK tagged) - Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 4, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, RNASE1 (mGFP-tagged) - Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 4, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Rnase1 (Myc-DDK-tagged) - Mouse ribonuclease, RNase A family, 1 (pancreatic) (Rnase1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
RNASE1 (GFP-tagged) - Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 4
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
RNASE1 (GFP-tagged) - Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 3
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Rnase1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN514864 is the updated version of KN314864.
Rnase1 (GFP-tagged) - Mouse ribonuclease, RNase A family, 1 (pancreatic) (Rnase1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Rnase1 (Myc-DDK-tagged) - Mouse ribonuclease, RNase A family, 1 (pancreatic) (Rnase1)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Rnase1 (Myc-DDK-tagged) - Mouse ribonuclease, RNase A family, 1 (pancreatic) (Rnase1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Rnase1 (mGFP-tagged) - Mouse ribonuclease, RNase A family, 1 (pancreatic) (Rnase1)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Rnase1 (GFP-tagged) - Mouse ribonuclease, RNase A family, 1 (pancreatic) (Rnase1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 4, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
5 Weeks
Lenti ORF particles, RNASE1 (Myc-DDK tagged) - Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 4, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 4, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
7 Weeks
Lenti ORF particles, RNASE1 (mGFP-tagged) - Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 4, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, RNASE1 (Myc-DDK tagged) - Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, RNASE1 (mGFP-tagged) - Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 3, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, RNASE1 (Myc-DDK tagged) - Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 3, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, RNASE1 (mGFP-tagged) - Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 3, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 2, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, RNASE1 (Myc-DDK tagged) - Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 2, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
6 Weeks
Lenti ORF particles, RNASE1 (mGFP-tagged) - Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 2, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
RNASE1 (GFP-tagged) - Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
RNASE1 (GFP-tagged) - Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Rnase1 (Myc-DDK-tagged ORF) - Rat ribonuclease, RNase A family, 1 (pancreatic) (Rnase1), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Rnase1 (Myc-DDK-tagged ORF) - Rat ribonuclease, RNase A family, 1 (pancreatic) (Rnase1), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Rnase1 (Myc-DDK-tagged ORF) - Rat ribonuclease, RNase A family, 1 (pancreatic) (Rnase1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Rnase1 (mGFP-tagged ORF) - Rat ribonuclease, RNase A family, 1 (pancreatic) (Rnase1), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Rnase1 (GFP-tagged ORF) - Rat ribonuclease, RNase A family, 1 (pancreatic) (Rnase1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 4, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
RNASE1 rabbit polyclonal antibody, Azide Free
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Bovine |
| Immunogen | Ribonuclease A isolated and purified from bovine pancreas. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
RNASE1 rabbit polyclonal antibody, Biotin
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Bovine |
| Conjugation | Biotin |
| Immunogen | Ribonuclease A isolated and purified from bovine pancreas. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
RNASE1 rabbit polyclonal antibody, Aff - Purified
| Applications | ELISA, ID, IF, IP, R, WB |
| Reactivities | Bovine |
| Immunogen | Ribonuclease A isolated and purified from bovine pancreas. Freund’s complete adjuvant is used in the first step of the immunization procedure. |
RNASE1 (untagged)-Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 4
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
RNASE1 (untagged)-Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 3
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-RNASE1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RNASE1 antibody: synthetic peptide directed towards the middle region of human RNASE1. Synthetic peptide located within the following region: MHITDCRLTNGSRYPNCAYRTSPKERHIIVACEGSPYVPVHFDASVEDST |
Rabbit Polyclonal Anti-RNASE1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-RNASE1 antibody: synthetic peptide directed towards the N terminal of human RNASE1. Synthetic peptide located within the following region: MALEKSLVRLLLLVLILLVLGWVQPSLGKESRAKKFQRQHMDSDSSPSSS |
RNASE1 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
RNASE1 rabbit polyclonal antibody, Serum
| Applications | ELISA, IP, WB |
| Reactivities | Bovine |
| Immunogen | Ribonuclease A [Bovine Pancreas]. |
RNASE1 rabbit polyclonal antibody, Biotin, Purified
| Applications | ELISA, IP, WB |
| Reactivities | Bovine |
| Conjugation | Biotin |
| Immunogen | Ribonuclease A from bovine pancreas |
Active filters
Target Symbol
- RNASE1