Products

View as table Download

RNASE1 (Myc-DDK-tagged)-Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

RNASE1 (Myc-DDK-tagged)-Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

RNASE1 (Myc-DDK-tagged)-Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

RNASE1 (Myc-DDK-tagged)-Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Recombinant protein of human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T

USD 68.00

USD 390.00

In Stock

Rnase1 (Myc-DDK-tagged) - Mouse ribonuclease, RNase A family, 1 (pancreatic) (Rnase1)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

RNASE1 (GFP-tagged) - Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

RNASE1 (GFP-tagged) - Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Rnase1 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN514864 is the updated version of KN314864.

Rnase1 (GFP-tagged) - Mouse ribonuclease, RNase A family, 1 (pancreatic) (Rnase1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Rnase1 (Myc-DDK-tagged) - Mouse ribonuclease, RNase A family, 1 (pancreatic) (Rnase1)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Rnase1 (Myc-DDK-tagged) - Mouse ribonuclease, RNase A family, 1 (pancreatic) (Rnase1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Rnase1 (mGFP-tagged) - Mouse ribonuclease, RNase A family, 1 (pancreatic) (Rnase1)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Rnase1 (GFP-tagged) - Mouse ribonuclease, RNase A family, 1 (pancreatic) (Rnase1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 4, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, RNASE1 (Myc-DDK tagged) - Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 4, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, RNASE1 (mGFP-tagged) - Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, RNASE1 (Myc-DDK tagged) - Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, RNASE1 (mGFP-tagged) - Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 3, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, RNASE1 (Myc-DDK tagged) - Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 3, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, RNASE1 (mGFP-tagged) - Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, RNASE1 (Myc-DDK tagged) - Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, RNASE1 (mGFP-tagged) - Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

RNASE1 (GFP-tagged) - Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

RNASE1 (GFP-tagged) - Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

Rnase1 (Myc-DDK-tagged ORF) - Rat ribonuclease, RNase A family, 1 (pancreatic) (Rnase1), (10 ug)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Rnase1 (Myc-DDK-tagged ORF) - Rat ribonuclease, RNase A family, 1 (pancreatic) (Rnase1), (10 ug)

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Rnase1 (Myc-DDK-tagged ORF) - Rat ribonuclease, RNase A family, 1 (pancreatic) (Rnase1), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Rnase1 (mGFP-tagged ORF) - Rat ribonuclease, RNase A family, 1 (pancreatic) (Rnase1), (10 ug)

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, Rnase1 (GFP-tagged ORF) - Rat ribonuclease, RNase A family, 1 (pancreatic) (Rnase1), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF clone of Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 4, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

RNASE1 rabbit polyclonal antibody, Azide Free

Applications ELISA, ID, IF, IP, R, WB
Reactivities Bovine
Immunogen Ribonuclease A isolated and purified from bovine pancreas. Freund’s complete adjuvant is used in the first step of the immunization procedure.

RNASE1 rabbit polyclonal antibody, Biotin

Applications ELISA, ID, IF, IP, R, WB
Reactivities Bovine
Conjugation Biotin
Immunogen Ribonuclease A isolated and purified from bovine pancreas. Freund’s complete adjuvant is used in the first step of the immunization procedure.

RNASE1 rabbit polyclonal antibody, Aff - Purified

Applications ELISA, ID, IF, IP, R, WB
Reactivities Bovine
Immunogen Ribonuclease A isolated and purified from bovine pancreas. Freund’s complete adjuvant is used in the first step of the immunization procedure.

RNASE1 (untagged)-Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 4

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

RNASE1 (untagged)-Human ribonuclease, RNase A family, 1 (pancreatic) (RNASE1), transcript variant 3

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

Rabbit Polyclonal Anti-RNASE1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RNASE1 antibody: synthetic peptide directed towards the middle region of human RNASE1. Synthetic peptide located within the following region: MHITDCRLTNGSRYPNCAYRTSPKERHIIVACEGSPYVPVHFDASVEDST

Rabbit Polyclonal Anti-RNASE1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RNASE1 antibody: synthetic peptide directed towards the N terminal of human RNASE1. Synthetic peptide located within the following region: MALEKSLVRLLLLVLILLVLGWVQPSLGKESRAKKFQRQHMDSDSSPSSS

RNASE1 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector

Format Lentiviral plasmids
Vector pGFP-C-shLenti
E. coli Selection Chloramphenicol
Mammalian Cell Selection Puromycin

RNASE1 rabbit polyclonal antibody, Serum

Applications ELISA, IP, WB
Reactivities Bovine
Immunogen Ribonuclease A [Bovine Pancreas].

RNASE1 rabbit polyclonal antibody, Biotin, Purified

Applications ELISA, IP, WB
Reactivities Bovine
Conjugation Biotin
Immunogen Ribonuclease A from bovine pancreas