Germany
Japan
United Kingdom
China
Products
View as table Download
Rabbit polyclonal STIP1 Antibody (Center)
| Applications | FC, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This STIP1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 269-297 amino acids from the Central region of human STIP1. |
Rabbit polyclonal STIP1 Antibody (C-term)
| Applications | FC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | This STIP1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 461-488 amino acids from the C-terminal region of human STIP1. |
Rabbit Polyclonal Anti-STIP1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-STIP1 antibody: synthetic peptide directed towards the C terminal of human STIP1. Synthetic peptide located within the following region: YQKALDLDSSCKEAADGYQRCMMAQYNRHDSPEDVKRRAMADPEVQQIMS |
Rabbit Polyclonal Anti-STIP1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-STIP1 antibody: synthetic peptide directed towards the N terminal of human STIP1. Synthetic peptide located within the following region: ALEFLNRFEEAKRTYEEGLKHEANNPQLKEGLQNMEARLAERKFMNPFNM |
STIP1 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human STIP1 |
STIP1 Rabbit polyclonal Antibody
| Applications | IF, IHC, IP, WB |
| Reactivities | Human, Monkey, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-300 of human STIP1 (NP_006810.1). |
| Modifications | Unmodified |
STIP1 Rabbit polyclonal Antibody
| Applications | FC, IF, IHC, IP, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthesized peptide derived from human STIP1 |
Active filters
Target Symbol
- STIP1
Conjugates
- Unconjugated