Rabbit polyclonal anti-TAF13 antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TAF13. |
Rabbit polyclonal anti-TAF13 antibody
Applications | IHC |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TAF13. |
Rabbit Polyclonal Anti-TAF13 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-TAF13 antibody: synthetic peptide directed towards the N terminal of human TAF13. Synthetic peptide located within the following region: ADEEEDPTFEEENEEIGGGAEGGQGKRKRLFSKELRCMMYGFGDDQNPYT |
TAF13 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-124 of human TAF13 (NP_005636.1). |
Modifications | Unmodified |