Germany
Japan
United Kingdom
China
TAF13 (Myc-DDK-tagged)-Human TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa (TAF13)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Lenti ORF particles, TAF13 (Myc-DDK tagged) - Human TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa (TAF13), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, TAF13 (mGFP-tagged) - Human TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa (TAF13), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
TAF13 (GFP-tagged) - Human TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa (TAF13)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Taf13 (Myc-DDK-tagged) - Mouse TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor (Taf13)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
TAF13 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN412721 is the updated version of KN212721.
Taf13 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN517139 is the updated version of KN317139.
Taf13 (GFP-tagged) - Mouse TAF13 RNA polymerase II TATA box binding protein (TBP)-associated factor (Taf13), (10ug)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Taf13 (Myc-DDK-tagged) - Mouse TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor (Taf13)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Taf13 (Myc-DDK-tagged) - Mouse TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor (Taf13), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Taf13 (mGFP-tagged) - Mouse TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor (Taf13)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Taf13 (GFP-tagged) - Mouse TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor (Taf13), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa (TAF13), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, TAF13 (Myc-DDK tagged) - Human TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa (TAF13), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa (TAF13), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, TAF13 (mGFP-tagged) - Human TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa (TAF13), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Taf13 (Myc-DDK-tagged ORF) - Rat TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor (Taf13), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Taf13 (Myc-DDK-tagged ORF) - Rat TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor (Taf13), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Taf13 (Myc-DDK-tagged ORF) - Rat TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor (Taf13), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Taf13 (mGFP-tagged ORF) - Rat TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor (Taf13), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Taf13 (GFP-tagged ORF) - Rat TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor (Taf13), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
TAF13 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Lenti ORF clone of Human TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa (TAF13), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa (TAF13), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit polyclonal anti-TAF13 antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human TAF13. |
Transient overexpression lysate of TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa (TAF13)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Rabbit Polyclonal Anti-TAF13 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-TAF13 antibody: synthetic peptide directed towards the N terminal of human TAF13. Synthetic peptide located within the following region: ADEEEDPTFEEENEEIGGGAEGGQGKRKRLFSKELRCMMYGFGDDQNPYT |
TAF13 CRISPRa kit - CRISPR gene activation of human TATA-box binding protein associated factor 13
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qSTAR qPCR primer pairs against Homo sapiens gene TAF13
| Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
Taf13 (untagged) - Mouse TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor (Taf13), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
qSTAR qPCR primer pairs against Mus musculus gene Taf13
AAV ORF Particles, serotype AAV-2, Taf13 (Myc-DDK-tagged) - Mouse TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor (Taf13), 250ul, >10^13 TU/mL
- AAV ORF®
-
TAF13 MS Standard C13 and N15-labeled recombinant protein (NP_005636)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
AAV ORF Particles, serotype AAV-2, TAF13 (Myc-DDK-tagged)-Human TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa (TAF13), 250ul, >10^13 TU/mL
- AAV ORF®
-
Taf13 (untagged ORF) - Rat TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor (Taf13), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
(untagged)-Homo sapiens, TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18 kD, clone MGC:22425 IMAGE:4289451, complete cds
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
TAF13 (untagged)-Human TAF13 RNA polymerase II, TATA box binding protein (TBP)-associated factor, 18kDa (TAF13)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
TAF13 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Taf13 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Taf13 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
TAF13 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-124 of human TAF13 (NP_005636.1). |
| Modifications | Unmodified |
Transient overexpression of TAF13 (NM_005645) in HEK293T cells paraffin embedded controls for ICC/IHC staining
TAF13 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
| E. coli Selection | Chloramphenicol |
| Mammalian Cell Selection | Puromycin |
TAF13 - Human shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Taf13 - Mouse, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Taf13 - Mouse shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Taf13 - Rat, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
Taf13 - Rat shRNA lentiviral particles (4 unique 29mer target-specific shRNA, 1 scramble control), 0.5 ml each, >10^7 TU/ml.
| Format | Lentiviral particles |
| Vector | pGFP-C-shLenti |
Purified recombinant protein of Mouse TATA-box binding protein associated factor 13 (Taf13), with C-terminal MYC/DDK tag, expressed in HEK293T cells, 20ug
| Tag | C-MYC/DDK |
| Expression Host | HEK293T |
TAF13 - Human, 4 unique 29mer shRNA constructs in retroviral untagged vector
| Format | Retroviral plasmids |
| Vector | pRS |
| E. coli Selection | Ampicillin |
| Mammalian Cell Selection | Puromycin |
Active filters
Target Symbol
- TAF13