Rabbit polyclonal anti-TNFSF15 antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human TNFSF15. |
Rabbit polyclonal anti-TNFSF15 antibody
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human TNFSF15. |
Biotinylated Anti-Human TL-1A Rabbit Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human TL-1A |
Anti-Human TL-1A Rabbit Polyclonal Antibody
Applications | ELISA |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | E.coli derived Recombinant Human TL-1A |
Rabbit Polyclonal anti-TNFSF15 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-TNFSF15 antibody is: synthetic peptide directed towards the C-terminal region of Human TNFSF15. Synthetic peptide located within the following region: CSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQP |
Rabbit Polyclonal Anti-TNFSF15 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human TNFSF15 |
TNFSF15 Antibody - C-terminal region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human TNFSF15 |
TNFSF15 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human TNFSF15 |
Recombinant Anti-TL1A (Clone TAN2-2)
Applications | Bl, FC, IF |
Reactivities | Mouse |
Conjugation | Unconjugated |
Modifications | This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG format, for improved compatibility with existing reagents, assays and techniques. |
Recombinant Anti-TL1A (Clone TAN2-2)
Applications | Bl, FC, IF |
Reactivities | Mouse |
Conjugation | Unconjugated |
Modifications | This reformatted rat antibody was made using the variable domain sequences of the original Rat IgG format, for improved compatibility with existing reagents, assays and techniques. |