Germany
Japan
United Kingdom
China
TNFSF15 (Myc-DDK-tagged)-Human tumor necrosis factor (ligand) superfamily, member 15 (TNFSF15), transcript variant 1
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Tnfsf15 (GFP-tagged) - Mouse tumor necrosis factor (ligand) superfamily, member 15 (Tnfsf15)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 820.00
3 Weeks
Lenti ORF particles, TNFSF15 (Myc-DDK tagged) - Human tumor necrosis factor (ligand) superfamily, member 15 (TNFSF15), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
USD 820.00
6 Weeks
Lenti ORF particles, TNFSF15 (mGFP-tagged) - Human tumor necrosis factor (ligand) superfamily, member 15 (TNFSF15), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
TNFSF15 (GFP-tagged) - Human tumor necrosis factor (ligand) superfamily, member 15 (TNFSF15), transcript variant 1
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Tnfsf15 (Myc-DDK-tagged) - Mouse tumor necrosis factor (ligand) superfamily, member 15 (Tnfsf15)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
TNFSF15 (Myc-DDK tagged) - Homo sapiens tumor necrosis factor (ligand) superfamily, member 15 (TNFSF15), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
TNFSF15 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN412177 is the updated version of KN212177.
Tnfsf15 - KN2.0, Mouse gene knockout kit via CRISPR, non-homology mediated.
| Format | 2 gRNA vectors, 1 linear donor |
| Donor DNA | EF1a-GFP-P2A-Puro |
KN518000 is the updated version of KN318000.
Lenti ORF clone of Tnfsf15 (Myc-DDK-tagged) - Mouse tumor necrosis factor (ligand) superfamily, member 15 (Tnfsf15)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Tnfsf15 (Myc-DDK-tagged) - Mouse tumor necrosis factor (ligand) superfamily, member 15 (Tnfsf15), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Tnfsf15 (mGFP-tagged) - Mouse tumor necrosis factor (ligand) superfamily, member 15 (Tnfsf15)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Tnfsf15 (GFP-tagged) - Mouse tumor necrosis factor (ligand) superfamily, member 15 (Tnfsf15), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human tumor necrosis factor (ligand) superfamily, member 15 (TNFSF15), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
5 Weeks
Lenti ORF particles, TNFSF15 (Myc-DDK tagged) - Human tumor necrosis factor (ligand) superfamily, member 15 (TNFSF15), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human tumor necrosis factor (ligand) superfamily, member 15 (TNFSF15), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
USD 820.00
3 Weeks
Lenti ORF particles, TNFSF15 (mGFP-tagged) - Human tumor necrosis factor (ligand) superfamily, member 15 (TNFSF15), transcript variant 1, 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
TNFSF15 (GFP-tagged) - Homo sapiens tumor necrosis factor (ligand) superfamily, member 15 (TNFSF15), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Tnfsf15 (Myc-DDK-tagged ORF) - Rat tumor necrosis factor (ligand) superfamily, member 15 (Tnfsf15), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Tnfsf15 (Myc-DDK-tagged ORF) - Rat tumor necrosis factor (ligand) superfamily, member 15 (Tnfsf15), (10 ug)
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Tnfsf15 (Myc-DDK-tagged ORF) - Rat tumor necrosis factor (ligand) superfamily, member 15 (Tnfsf15), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Tnfsf15 (mGFP-tagged ORF) - Rat tumor necrosis factor (ligand) superfamily, member 15 (Tnfsf15), (10 ug)
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, Tnfsf15 (GFP-tagged ORF) - Rat tumor necrosis factor (ligand) superfamily, member 15 (Tnfsf15), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Tnfsf15 (untagged) - Mouse tumor necrosis factor (ligand) superfamily, member 15 (Tnfsf15), (10ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
TNFSF15 (untagged)-Human tumor necrosis factor (ligand) superfamily, member 15 (TNFSF15), transcript variant 1
| Vector | pCMV6-XL6 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF clone of Human tumor necrosis factor (ligand) superfamily, member 15 (TNFSF15), transcript variant 1, Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
TNFSF15 (untagged) - Homo sapiens tumor necrosis factor (ligand) superfamily, member 15 (TNFSF15), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Purified recombinant protein of Human tumor necrosis factor (ligand) superfamily, member 15 (TNFSF15), transcript variant 1.
| Tag | Tag Free |
| Expression Host | E. coli |
Lenti ORF clone of Human tumor necrosis factor (ligand) superfamily, member 15 (TNFSF15), transcript variant 1, mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
TNFSF15 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Transient overexpression lysate of tumor necrosis factor (ligand) superfamily, member 15 (TNFSF15)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Anti-Human TL-1A Rabbit Polyclonal Antibody
| Applications | ELISA |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | E.coli derived Recombinant Human TL-1A |
Rabbit Polyclonal anti-TNFSF15 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-TNFSF15 antibody is: synthetic peptide directed towards the C-terminal region of Human TNFSF15. Synthetic peptide located within the following region: CSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQP |
TNFSF15 - Human, 4 unique 29mer shRNA constructs in lentiviral GFP vector
| Format | Lentiviral plasmids |
| Vector | pGFP-C-shLenti |
TNFSF15 (72-251, His-tag) human recombinant protein, 0.5 mg
| Tag | His-tag |
| Expression Host | E. coli |
TNFSF15 (72-251, His-tag) human recombinant protein, 0.1 mg
| Tag | His-tag |
| Expression Host | E. coli |
TNFSF15 CRISPRa kit - CRISPR gene activation of human TNF superfamily member 15
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
Tnfsf15 CRISPRa kit - CRISPR gene activation of mouse tumor necrosis factor (ligand) superfamily, member 15
| Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qSTAR qPCR primer pairs against Homo sapiens gene TNFSF15
qSTAR qPCR primer pairs against Mus musculus gene Tnfsf15
Tnfsf15 (untagged ORF) - Rat tumor necrosis factor (ligand) superfamily, member 15 (Tnfsf15), (10 ug)
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
3`UTR clone of tumor necrosis factor (ligand) superfamily member 15 (TNFSF15) for miRNA target validation
| Vector | pMirTarget |
| Mammalian Cell Selection | Neomycin |
| Species | Human |
| Transfection Reporter | RFP |
| Assay Reporter | Luciferase |
Tnfsf15 (Mouse) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Tnfsf15 (Rat) - 3 unique 27mer siRNA duplexes - 2 nmol each
| Purity | HPLC purified |
| Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
TNFSF15 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human TNFSF15 |
Active filters
Target Symbol
- TNFSF15
Filter by
Species
Antibody Hosts
Isotypes
Clonalities
Conjugates
Expression Hosts
Lentivirus
Tags
Vectors
Modifications
- This chimeric rabbit antibody was made using the variable domain sequences of the original Rat IgG format, for improved compatibility with existing reagents, assays and techniques. (1)
- This reformatted rat antibody was made using the variable domain sequences of the original Rat IgG format, for improved compatibility with existing reagents, assays and techniques. (1)