Germany
Japan
United Kingdom
China
GATA1 (Myc-DDK-tagged)-Human GATA binding protein 1 (globin transcription factor 1) (GATA1)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
GATA1 (untagged)- Human GATA binding protein 1 (globin transcription factor 1), 10ug
| Vector | pCMV6-XL4 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
Lenti ORF particles, GATA1 (Myc-DDK tagged) - Human GATA binding protein 1 (globin transcription factor 1) (GATA1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, GATA1 (mGFP-tagged) - Human GATA binding protein 1 (globin transcription factor 1) (GATA1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
GATA1 (GFP-tagged) - Human GATA binding protein 1 (globin transcription factor 1) (GATA1)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF particles, GATA1 (Myc-DDK tagged) - Human GATA binding protein 1 (globin transcription factor 1) (GATA1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human GATA binding protein 1 (globin transcription factor 1) (GATA1), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, GATA1 (mGFP-tagged) - Human GATA binding protein 1 (globin transcription factor 1) (GATA1), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
GATA1 Mutant (V205M), Myc-DDK-tagged ORF clone of Homo sapiens GATA binding protein 1 (globin transcription factor 1) (GATA1) as transfection-ready DNA
| Mutation | V205M |
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GATA1 Mutant (G208R), Myc-DDK-tagged ORF clone of Homo sapiens GATA binding protein 1 (globin transcription factor 1) (GATA1) as transfection-ready DNA
| Mutation | G208R |
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GATA1 Mutant (R216Q), Myc-DDK-tagged ORF clone of Homo sapiens GATA binding protein 1 (globin transcription factor 1) (GATA1) as transfection-ready DNA
| Mutation | R216Q |
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GATA1 Mutant (R216W), Myc-DDK-tagged ORF clone of Homo sapiens GATA binding protein 1 (globin transcription factor 1) (GATA1) as transfection-ready DNA
| Mutation | R216W |
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GATA1 Mutant (D218G), Myc-DDK-tagged ORF clone of Homo sapiens GATA binding protein 1 (globin transcription factor 1) (GATA1) as transfection-ready DNA
| Mutation | D218G |
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
GATA1 Mutant (D218Y), Myc-DDK-tagged ORF clone of Homo sapiens GATA binding protein 1 (globin transcription factor 1) (GATA1) as transfection-ready DNA
| Mutation | D218Y |
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human GATA binding protein 1 (globin transcription factor 1) (GATA1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Lenti ORF clone of Human GATA binding protein 1 (globin transcription factor 1) (GATA1), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Purified recombinant protein of Human GATA binding protein 1 (globin transcription factor 1) (GATA1), full length, with N-terminal HIS tag, expressed in E. coli, 50ug
| Tag | N-His |
| Expression Host | E. coli |
Transient overexpression lysate of GATA binding protein 1 (globin transcription factor 1) (GATA1)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Special Offer: Get a 20% discount on this product. Use code: "OEL20".
Lenti ORF clone of Human GATA binding protein 1 (globin transcription factor 1) (GATA1), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal GATA1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human GATA1 |
Rabbit Polyclonal GATA1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human GATA1 |
Rabbit Polyclonal GATA1 (Ser142) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human GATA1 around the phosphorylation site of Serine 142 |
| Modifications | Phospho-specific |
Rabbit Polyclonal GATA1 (Ser310) Antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against A synthesized peptide derived from human GATA1 around the phosphorylation site of Serine 310 |
| Modifications | Phospho-specific |
GATA1 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Rabbit anti-GATA1 (Phospho-Ser142) polyclonal antibody (Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanGATA-1 around the phosphorylation site of serine 142 (R-L-SP-P-D). |
| Modifications | Phospho-specific |
GATA1 pSer142 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
GATA1 pSer310 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
GATA1 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
GATA1 rabbit polyclonal antibody, Aff - Purified
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
Goat Polyclonal Antibody against GATA1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DAEAYRHSPVFQ, from the internal region of the protein sequence according to NP_002040.1. |
Rabbit anti-GATA1 (Phospho-Ser310) polyclonal antibody (Phospho-specific)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from humanGATA1 around the phosphorylation site of serine 310 (K-A-SP-G-K). |
| Modifications | Phospho-specific |
Rabbit Polyclonal Anti-GATA1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-GATA1 antibody: synthetic peptide directed towards the N terminal of human GATA1. Synthetic peptide located within the following region: SGPEGLDAAASSTAPSTATAAAAALAYYRDAEAYRHSPVFQVYPLLNCME |
Rabbit anti GATA1(pS142) Polyclonal Antibody
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
Transient overexpression of GATA1 (NM_002049) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GATA1 (NM_002049) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GATA1 (NM_002049) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- GATA1
Families
- Adult stem cells