Products

Jump to Filters
View as table Download
HOXD10 Rabbit Polyclonal Antibody
TA590707

USD 409.00

In Stock

Rabbit Polyclonal HOXD10 Antibody

Applications ELISA
Reactivities Human
Conjugation Unconjugated
Immunogen DNA immunization. This antibody is specific for the Middle Region of the target protein.
HOXD10 Goat Polyclonal Antibody
TA305778

USD 375.00

5 Days

Goat Anti-HOXD10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence PNRSCRIEQPVTQQ, from the internal region of the protein sequence according to NP_002139.2.
HOXD10 Rabbit Polyclonal Antibody
TA330143

USD 375.00

5 Days

Rabbit Polyclonal Anti-HOXD10 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-HOXD10 antibody: synthetic peptide directed towards the middle region of human HOXD10. Synthetic peptide located within the following region: NPEVPVPGYFRLSQTYATGKTQEYNNSPEGSSTVMLQLNPRGAAKPQLSA