Germany
Japan
United Kingdom
China
Products
View as table Download
Goat Polyclonal Antibody against IKZF1
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-DLLRAASENSQDALR, from the internal region of the protein sequence according to NP_006051.1. |
Rabbit Polyclonal Anti-ZNFN1A1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ZNFN1A1 antibody: synthetic peptide directed towards the middle region of human ZNFN1A1. Synthetic peptide located within the following region: LHKPLAEGTPRSNHSAQDSAVENLLLLSKAKLVPSEREASPSNSCQDSTD |
Rabbit Polyclonal anti-IKZF1 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IKZF1 antibody: synthetic peptide directed towards the middle region of human IKZF1. Synthetic peptide located within the following region: DLCKIGSERSLVLDRLASNVAKRKSSMPQKFLGDKGLSDTPYDSSASYEK |
Rabbit Polyclonal Anti-IKZF1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-IKZF1 antibody: synthetic peptide directed towards the middle region of human IKZF1. Synthetic peptide located within the following region: QDSTDTESNNEEQRSGLIYLTNHIAPHARNGLSLKEEHRAYDLLRAASEN |
Active filters
Target Symbol
- IKZF1
Isotypes
- IgG
Families
- Druggable Genome