Lenti-ORF clone of HCK (mGFP-tagged)-Human hemopoietic cell kinase (HCK), transcript variant 2
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
- LentiORF®
Lenti-ORF clone of HCK (mGFP-tagged)-Human hemopoietic cell kinase (HCK), transcript variant 2
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Lenti-ORF clone of HCK (Myc-DDK-tagged)-Human hemopoietic cell kinase (HCK), transcript variant 2
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Lenti-ORF clone of HCK (mGFP-tagged)-Human hemopoietic cell kinase (HCK), transcript variant 2
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
HCK (untagged)-Kinase deficient mutant (K269M) of Human hemopoietic cell kinase (HCK)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit polyclonal HCK Antibody (N-term)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This HCK antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 131-156 amino acids from the N-terminal region of human HCK. |
HCK HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
HCK HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of hemopoietic cell kinase (HCK), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-HCK Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-HCK antibody is: synthetic peptide directed towards the C-terminal region of Human HCK. Synthetic peptide located within the following region: LVKLHAVVTKEPIYIITEFMAKGSLLDFLKSDEGSKQPLPKLIDFSAQIA |
Rabbit polyclonal HCK (Tyr521) antibody(Phospho-specific)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human HCK around the phosphorylation site of tyrosine 521. |
Modifications | Phospho-specific |
HCK HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of hemopoietic cell kinase (HCK), transcript variant 3
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
HCK MS Standard C13 and N15-labeled recombinant protein (NP_002101)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
HCK (untagged)-Human hemopoietic cell kinase (HCK) transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
HCK (untagged)-Human hemopoietic cell kinase (HCK) transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
HCK (untagged)-Human hemopoietic cell kinase (HCK) transcript variant 4
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
HCK (untagged)-Human hemopoietic cell kinase (HCK) transcript variant 3
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
HCK (untagged)-Human hemopoietic cell kinase (HCK) transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression of HCK (NM_002110) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of HCK (NM_001172131) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of HCK (NM_001172129) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of HCK (NM_001172133) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of HCK (NM_001172132) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of HCK (NM_001172130) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of HCK (NM_002110) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of HCK (NM_002110) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of HCK (NM_001172131) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of HCK (NM_001172131) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of HCK (NM_001172129) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of HCK (NM_001172129) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of HCK (NM_001172133) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of HCK (NM_001172132) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of HCK (NM_001172132) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of HCK (NM_001172130) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of HCK (NM_001172130) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack