E2F3 (Myc-DDK-tagged)-Human E2F transcription factor 3 (E2F3)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
E2F3 (Myc-DDK-tagged)-Human E2F transcription factor 3 (E2F3)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, E2F3 (Myc-DDK tagged) - Human E2F transcription factor 3 (E2F3), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, E2F3 (mGFP-tagged) - Human E2F transcription factor 3 (E2F3), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
E2F3 (GFP-tagged) - Human E2F transcription factor 3 (E2F3)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
E2F3 (Myc-DDK tagged) - Homo sapiens E2F transcription factor 3 (E2F3), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human E2F transcription factor 3 (E2F3), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, E2F3 (Myc-DDK tagged) - Human E2F transcription factor 3 (E2F3), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, E2F3 (mGFP-tagged) - Human E2F transcription factor 3 (E2F3), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
E2F3 (GFP-tagged) - Homo sapiens E2F transcription factor 3 (E2F3), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
E2F3 (untagged)-Human E2F transcription factor 3 (E2F3)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Purified recombinant protein of Human E2F transcription factor 3 (E2F3), full length, with N-terminal HIS tag, expressed in E.Coli, 50ug
Tag | N-His |
Expression Host | E. coli |
Rabbit Polyclonal Anti-E2F3 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | E2F3 antibody was raised against a 15 amino acid peptide near the center of human E2F3. |
Lenti ORF clone of Human E2F transcription factor 3 (E2F3), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human E2F transcription factor 3 (E2F3), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Transient overexpression lysate of E2F transcription factor 3 (E2F3)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
E2F3 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Lenti ORF clone of Human E2F transcription factor 3 (E2F3), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Goat Polyclonal Anti-E2F3 (mouse) Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | C Terminus of NP_034223.1 (DLEKLPLVEDFMCS) |
Rabbit Polyclonal Anti-E2F3 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-E2F3 antibody: synthetic peptide directed towards the C terminal of human E2F3. Synthetic peptide located within the following region: LLQQTEDQIPSNLEGPFVNLLPPLLQEDYLLSLGEEEGISDLFDAYDLEK |
E2F3 (untagged) - Homo sapiens E2F transcription factor 3 (E2F3), transcript variant 2
Vector | pCMV6 series |
Tag | Tag Free |
Transient overexpression of E2F3 (NM_001949) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of E2F3 (NM_001243076) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of E2F3 (NM_001949) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of E2F3 (NM_001949) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of E2F3 (NM_001243076) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of E2F3 (NM_001243076) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack