Products

cDNA Clones (11)
Proteins (8)
Antibodies (7)
Jump to Filters
View as table Download
Cullin 1 (CUL1) (NM_003592) Human Tagged ORF Clone
RG224650

USD 670.00

In Stock

CUL1 (GFP-tagged) - Human cullin 1 (CUL1)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Cullin 1 (CUL1) (NM_003592) Human Untagged Clone
SC108409

USD 760.00

In Stock

CUL1 (untagged)-Human cullin 1 (CUL1)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Cullin 1 (CUL1) Rabbit Polyclonal Antibody
TA313012

USD 345.00

In Stock

Rabbit polyclonal anti-Cullin 1 antibody

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Cullin 1.
Cullin 1 (CUL1) Rabbit Polyclonal Antibody
TA347362

USD 380.00

4 Weeks

Rabbit Polyclonal Anti-Cullin 1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-Cullin 1 Antibody: A synthesized peptide derived from human Cullin 1
Cullin 1 (CUL1) Rabbit Polyclonal Antibody
AP06077PU-N

USD 370.00

2 Weeks

Cullin 1 (CUL1) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse
Cullin 1 (CUL1) (NM_003592) Human Tagged ORF Clone
RC224650L2

USD 810.00

3 Weeks

Lenti ORF clone of Human cullin 1 (CUL1), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Cullin 1 (CUL1) Rabbit Polyclonal Antibody
TA327291

USD 345.00

3 Weeks

CUL1 Rabbit Polyclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human CUL1
Cullin 1 (CUL1) (NM_003592) Human Over-expression Lysate
LC418561

USD 187.00

In Stock

CUL1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Cullin 1 (CUL1) (C-term) Rabbit Polyclonal Antibody
AP51139PU-N

USD 450.00

2 Weeks

Cullin 1 (CUL1) (C-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 679-708 amino acids from the C-terminal region of human CUL1
Cullin 1 (CUL1) Rabbit Polyclonal Antibody
TA319256

USD 530.00

5 Days

Rabbit polyclonal anti-Cul1 antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen This antibody was prepared from whole rabbit serum produced by repeated immunizations with a synthetic peptide corresponding to amino acids 766-776 of Human Cul1 (C-terminus) coupled to KLH.
Cullin 1 (CUL1) Rabbit Polyclonal Antibody
TA330371

USD 310.00

5 Days

Rabbit Polyclonal Anti-CUL1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CUL1 antibody: synthetic peptide directed towards the C terminal of human CUL1. Synthetic peptide located within the following region: HQQLLGEVLTQLSSRFKPRVPVIKKCIDILIEKEYLERVDGEKDTYSYLA
Cullin 1 (1-410, His-tag) Human Protein
AR09691PU-L

USD 845.00

2 Weeks

Cullin 1 (1-410, His-tag) human recombinant protein, 0.25 mg

Tag His-tag
Expression Host E. coli
Cullin 1 (1-410, His-tag) Human Protein
AR09691PU-N

USD 330.00

2 Weeks

Cullin 1 (1-410, His-tag) human recombinant protein, 50 µg

Tag His-tag
Expression Host E. coli
Cullin 1 (CUL1) (NM_003592) Human Over-expression Lysate
LY418561

USD 605.00

5 Days

Transient overexpression lysate of cullin 1 (CUL1)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Cullin 1 (CUL1) (NM_003592) Human Mass Spec Standard
PH324650

USD 2,055.00

3 Weeks

CUL1 MS Standard C13 and N15-labeled recombinant protein (NP_003583)

Tag C-Myc/DDK
Expression Host HEK293
Cullin 1 (CUL1) (AF062536) Human Untagged Clone
SC314670

USD 1,750.00

5 Weeks

(untagged)-Human cullin 1 mRNA, complete cds

Vector pCMV6 series
Tag Tag Free
Cullin 1 (CUL1) (NM_003592) ICC Control Block
TB424650

USD 1,260.00

4 Weeks

Transient overexpression of CUL1 (NM_003592) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Cullin 1 (CUL1) Cytosection
TS424650

USD 225.00

4 Weeks

Transient overexpression of CUL1 (NM_003592) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Cullin 1 (CUL1) Cytosection
TS424650P5

USD 889.00

4 Weeks

Transient overexpression of CUL1 (NM_003592) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack