Germany
Japan
United Kingdom
China
E2F4 (Myc-DDK-tagged)-Human E2F transcription factor 4, p107/p130-binding (E2F4)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
E2F4 (GFP-tagged) - Human E2F transcription factor 4, p107/p130-binding (E2F4)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human E2F transcription factor 4, p107/p130-binding (E2F4), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, E2F4 (Myc-DDK tagged) - Human E2F transcription factor 4, p107/p130-binding (E2F4), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF clone of Human E2F transcription factor 4, p107/p130-binding (E2F4), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, E2F4 (mGFP-tagged) - Human E2F transcription factor 4, p107/p130-binding (E2F4), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
E2F4 (untagged)-Human E2F transcription factor 4, p107/p130-binding (E2F4)
| Vector | pCMV6-AC |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Transient overexpression lysate of E2F transcription factor 4, p107/p130-binding (E2F4)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit Polyclonal Anti-E2F4 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-E2F4 Antibody: A synthesized peptide derived from human E2F4 |
E2F4 HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Rabbit Polyclonal anti-E2F4 antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-E2F4 antibody: synthetic peptide directed towards the C terminal of human E2F4. Synthetic peptide located within the following region: SSELLEELMSSEVFAPLLRLSPPPGDHDYIYNLDESEGVCDLFDVPVLNL |
Goat Polyclonal Anti-E2F4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | internal region of NP_001941.2 (DPTGVLELPKELSE) |
Goat Polyclonal Anti-Transcription factor E2F4 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | internal region of NP_001941.2 (PKELSEIFDPTR) |
Carrier-free (BSA/glycerol-free) E2F4 mouse monoclonal antibody,clone OTI10E7
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) E2F4 mouse monoclonal antibody,clone OTI11H1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-E2F4 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human E2F4 |
E2F4 mouse monoclonal antibody,clone OTI10E7
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
E2F4 mouse monoclonal antibody,clone OTI10E7, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
E2F4 mouse monoclonal antibody,clone OTI10E7, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
E2F4 mouse monoclonal antibody,clone OTI10E7
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
E2F4 mouse monoclonal antibody,clone OTI11H1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
E2F4 mouse monoclonal antibody,clone OTI11H1, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
E2F4 mouse monoclonal antibody,clone OTI11H1, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
E2F4 mouse monoclonal antibody,clone OTI11H1
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Transient overexpression of E2F4 (NM_001950) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of E2F4 (NM_001950) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of E2F4 (NM_001950) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Active filters
Target Symbol
- E2F4
Families
- Druggable Genome
Pathways
- Cell cycle