Products

cDNA Clones (23)
Proteins (12)
Antibodies (3)
Jump to Filters
View as table Download
Carboxylesterase 7 (CES5A) (NM_001190158) Human Tagged ORF Clone
RC231334

USD 480.00

In Stock

CES5A (Myc-DDK-tagged)-Human carboxylesterase 5A (CES5A), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Carboxylesterase 7 (CES5A) (NM_145024) Human Tagged ORF Clone Lentiviral Particle
RC210205L3V

USD 880.00

5 Weeks

Lenti ORF particles, CES5A (Myc-DDK tagged) - Human carboxylesterase 5A (CES5A), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Carboxylesterase 7 (CES5A) (NM_145024) Human Tagged ORF Clone Lentiviral Particle
RC210205L4V

USD 880.00

7 Weeks

Lenti ORF particles, CES5A (mGFP-tagged) - Human carboxylesterase 5A (CES5A), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Carboxylesterase 7 (CES5A) (NM_001143685) Human Tagged ORF Clone
RC226746

USD 600.00

2 Weeks

CES5A (Myc-DDK-tagged)-Human carboxylesterase 5A (CES5A), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Carboxylesterase 7 (CES5A) (NM_001143685) Human Tagged ORF Clone Lentiviral Particle
RC226746L3V

USD 1,000.00

7 Weeks

Lenti ORF particles, CES5A (Myc-DDK-tagged)-Human carboxylesterase 5A (CES5A), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Carboxylesterase 7 (CES5A) (NM_001143685) Human Tagged ORF Clone Lentiviral Particle
RC226746L4V

USD 1,000.00

7 Weeks

Lenti ORF particles, CES5A (mGFP-tagged)-Human carboxylesterase 5A (CES5A), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Carboxylesterase 7 (CES5A) (NM_001190158) Human Tagged ORF Clone Lentiviral Particle
RC231334L3V

USD 880.00

6 Weeks

Lenti ORF particles, CES5A (Myc-DDK-tagged)-Human carboxylesterase 5A (CES5A), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Carboxylesterase 7 (CES5A) (NM_001190158) Human Tagged ORF Clone Lentiviral Particle
RC231334L4V

USD 880.00

6 Weeks

Lenti ORF particles, CES5A (mGFP-tagged)-Human carboxylesterase 5A (CES5A), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Carboxylesterase 7 (CES5A) (NM_145024) Human Tagged ORF Clone
RG210205

USD 530.00

3 Weeks

CES5A (GFP-tagged) - Human carboxylesterase 5A (CES5A), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Carboxylesterase 7 (CES5A) (NM_001143685) Human Tagged ORF Clone
RG226746

USD 660.00

4 Weeks

CES5A (GFP-tagged) - Human carboxylesterase 5A (CES5A), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Carboxylesterase 7 (CES5A) (NM_001190158) Human Tagged ORF Clone
RG231334

USD 530.00

3 Weeks

CES5A (GFP-tagged) - Human carboxylesterase 5A (CES5A), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Carboxylesterase 7 (CES5A) (NM_145024) Human Tagged ORF Clone
RC210205L2

USD 680.00

3 Weeks

Lenti ORF clone of Human carboxylesterase 5A (CES5A), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Carboxylesterase 7 (CES5A) (NM_145024) Human Untagged Clone
SC100049

USD 760.00

In Stock

CES5A (untagged)-Human carboxylesterase 5A (CES5A), transcript variant 2

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Carboxylesterase 7 (CES5A) (Center) Rabbit Polyclonal Antibody
AP50870PU-N

USD 450.00

2 Weeks

Carboxylesterase 7 (CES5A) (Center) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide selected from the Center region of human CES7
Carboxylesterase 7 (CES5A) (NM_145024) Human Over-expression Lysate
LY408085

USD 396.00

5 Days

Transient overexpression lysate of carboxylesterase 7 (CES7), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Carboxylesterase 7 (CES5A) Rabbit Polyclonal Antibody
TA339870

USD 375.00

5 Days

Rabbit Polyclonal Anti-CES5A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CES7 antibody: synthetic peptide directed towards the N terminal of human CES7. Synthetic peptide located within the following region: SGNWVHPGQILIWAIWVLAAPTKGPSAEGPQRNTRLGWIQGKQVTVLGSP
Carboxylesterase 7 (CES5A) Rabbit Polyclonal Antibody
TA339871

USD 375.00

5 Days

Rabbit Polyclonal Anti-CES5A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-CES7 antibody: synthetic peptide directed towards the middle region of human CES7. Synthetic peptide located within the following region: LTEIRDSLLDLLGDVFFVVPALITARYHREGATEEEKLLSRKMMKYWATF
Carboxylesterase 7 (CES5A) (NM_145024) Human Over-expression Lysate
LC408085

USD 121.00

2 Weeks

CES5A HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Carboxylesterase 7 (CES5A) (NM_145024) Human Mass Spec Standard
PH310205

USD 2,055.00

3 Weeks

CES7 MS Standard C13 and N15-labeled recombinant protein (NP_659461)

Tag C-Myc/DDK
Expression Host HEK293
Carboxylesterase 7 (CES5A) (NM_145024) ICC Control Block
TB410205

USD 1,130.00

4 Weeks

Transient overexpression of CES5A (NM_145024) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Carboxylesterase 7 (CES5A) (NM_001143685) ICC Control Block
TB426746

USD 1,250.00

4 Weeks

Transient overexpression of CES5A (NM_001143685) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Carboxylesterase 7 (CES5A) (NM_001190158) ICC Control Block
TB431334

USD 1,130.00

4 Weeks

Transient overexpression of CES5A (NM_001190158) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Carboxylesterase 7 (CES5A) Cytosection
TS410205

USD 225.00

4 Weeks

Transient overexpression of CES5A (NM_145024) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Carboxylesterase 7 (CES5A) Cytosection
TS410205P5

USD 889.00

4 Weeks

Transient overexpression of CES5A (NM_145024) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Carboxylesterase 7 (CES5A) ICC Control Sections
TS426746P5

USD 889.00

4 Weeks

Transient overexpression of CES5A (NM_001143685) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Carboxylesterase 7 (CES5A) Cytosection
TS431334

USD 225.00

4 Weeks

Transient overexpression of CES5A (NM_001190158) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Carboxylesterase 7 (CES5A) Cytosection
TS431334P5

USD 889.00

4 Weeks

Transient overexpression of CES5A (NM_001190158) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack