CES5A (Myc-DDK-tagged)-Human carboxylesterase 5A (CES5A), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
CES5A (Myc-DDK-tagged)-Human carboxylesterase 5A (CES5A), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 880.00
3 Weeks
Lenti ORF particles, CES5A (Myc-DDK tagged) - Human carboxylesterase 5A (CES5A), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 880.00
6 Weeks
Lenti ORF particles, CES5A (mGFP-tagged) - Human carboxylesterase 5A (CES5A), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Recombinant protein of human carboxylesterase 7 (CES7), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
CES5A (Myc-DDK-tagged)-Human carboxylesterase 5A (CES5A), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human carboxylesterase 5A (CES5A), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 880.00
5 Weeks
Lenti ORF particles, CES5A (Myc-DDK tagged) - Human carboxylesterase 5A (CES5A), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human carboxylesterase 5A (CES5A), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 880.00
7 Weeks
Lenti ORF particles, CES5A (mGFP-tagged) - Human carboxylesterase 5A (CES5A), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CES5A (Myc-DDK-tagged)-Human carboxylesterase 5A (CES5A), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of CES5A (Myc-DDK-tagged)-Human carboxylesterase 5A (CES5A), transcript variant 1
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 1,000.00
7 Weeks
Lenti ORF particles, CES5A (Myc-DDK-tagged)-Human carboxylesterase 5A (CES5A), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of CES5A (mGFP-tagged)-Human carboxylesterase 5A (CES5A), transcript variant 1
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 1,000.00
7 Weeks
Lenti ORF particles, CES5A (mGFP-tagged)-Human carboxylesterase 5A (CES5A), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of CES5A (Myc-DDK-tagged)-Human carboxylesterase 5A (CES5A), transcript variant 3
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 880.00
6 Weeks
Lenti ORF particles, CES5A (Myc-DDK-tagged)-Human carboxylesterase 5A (CES5A), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of CES5A (mGFP-tagged)-Human carboxylesterase 5A (CES5A), transcript variant 3
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 880.00
6 Weeks
Lenti ORF particles, CES5A (mGFP-tagged)-Human carboxylesterase 5A (CES5A), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
CES5A (GFP-tagged) - Human carboxylesterase 5A (CES5A), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CES5A (GFP-tagged) - Human carboxylesterase 5A (CES5A), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
CES5A (GFP-tagged) - Human carboxylesterase 5A (CES5A), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human carboxylesterase 5A (CES5A), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
CES5A (untagged)-Human carboxylesterase 5A (CES5A), transcript variant 2
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Carboxylesterase 7 (CES5A) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide selected from the Center region of human CES7 |
Transient overexpression lysate of carboxylesterase 7 (CES7), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-CES5A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CES7 antibody: synthetic peptide directed towards the N terminal of human CES7. Synthetic peptide located within the following region: SGNWVHPGQILIWAIWVLAAPTKGPSAEGPQRNTRLGWIQGKQVTVLGSP |
Rabbit Polyclonal Anti-CES5A Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-CES7 antibody: synthetic peptide directed towards the middle region of human CES7. Synthetic peptide located within the following region: LTEIRDSLLDLLGDVFFVVPALITARYHREGATEEEKLLSRKMMKYWATF |
CES5A HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
CES7 MS Standard C13 and N15-labeled recombinant protein (NP_659461)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
CES5A (untagged)-Human carboxylesterase 5A (CES5A), transcript variant 1
Vector | pCMV6 series |
Tag | Tag Free |
Transient overexpression of CES5A (NM_145024) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CES5A (NM_001143685) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CES5A (NM_001190158) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of CES5A (NM_145024) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CES5A (NM_145024) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CES5A (NM_001143685) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of CES5A (NM_001190158) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of CES5A (NM_001190158) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack