USP8 (Myc-DDK-tagged)-Human ubiquitin specific peptidase 8 (USP8), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USP8 (Myc-DDK-tagged)-Human ubiquitin specific peptidase 8 (USP8), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USP8 (Myc-DDK-tagged)-Human ubiquitin specific peptidase 8 (USP8), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USP8 (Myc-DDK-tagged)-Human ubiquitin specific peptidase 8 (USP8), transcript variant 3
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, USP8 (Myc-DDK tagged) - Human ubiquitin specific peptidase 8 (USP8), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, USP8 (mGFP-tagged) - Human ubiquitin specific peptidase 8 (USP8), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
USP8 (GFP-tagged) - Human ubiquitin specific peptidase 8 (USP8), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, USP8 (Myc-DDK tagged) - Human ubiquitin specific peptidase 8 (USP8), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human ubiquitin specific peptidase 8 (USP8), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, USP8 (mGFP-tagged) - Human ubiquitin specific peptidase 8 (USP8), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of USP8 (Myc-DDK-tagged)-Human ubiquitin specific peptidase 8 (USP8), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, USP8 (Myc-DDK-tagged)-Human ubiquitin specific peptidase 8 (USP8), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of USP8 (mGFP-tagged)-Human ubiquitin specific peptidase 8 (USP8), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, USP8 (mGFP-tagged)-Human ubiquitin specific peptidase 8 (USP8), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of USP8 (Myc-DDK-tagged)-Human ubiquitin specific peptidase 8 (USP8), transcript variant 3
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, USP8 (Myc-DDK-tagged)-Human ubiquitin specific peptidase 8 (USP8), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of USP8 (mGFP-tagged)-Human ubiquitin specific peptidase 8 (USP8), transcript variant 3
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, USP8 (mGFP-tagged)-Human ubiquitin specific peptidase 8 (USP8), transcript variant 3, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USP8 (myc-DDK-tagged) - Human ubiquitin specific peptidase 8 (USP8), transcript variant 4
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USP8 (GFP-tagged) - Human ubiquitin specific peptidase 8 (USP8), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USP8 (GFP-tagged) - Human ubiquitin specific peptidase 8 (USP8), transcript variant 3
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human ubiquitin specific peptidase 8 (USP8), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
USP8 (untagged)-Human ubiquitin specific peptidase 8 (USP8), transcript variant 1
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human ubiquitin specific peptidase 8 (USP8), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Rabbit Polyclonal Anti-USP8 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-USP8 antibody: synthetic peptide directed towards the C terminal of human USP8. Synthetic peptide located within the following region: FAGYSQQDSQELLLFLMDGLHEDLNKADNRKRYKEENNDHLDDFKAAEHA |
Lenti ORF clone of Human ubiquitin specific peptidase 8 (USP8), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Transient overexpression lysate of ubiquitin specific peptidase 8 (USP8), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
USP8 (untagged)-Human ubiquitin specific peptidase 8 (USP8), transcript variant 2
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-USP8 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-USP8 antibody: synthetic peptide directed towards the N terminal of human USP8. Synthetic peptide located within the following region: KGSLENVLDSKDKTQKSNGEKNEKCETKEKGAITAKELYTMMTDKNISLI |
USP8 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
USP8 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
USP8 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of ubiquitin specific peptidase 8 (USP8), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of ubiquitin specific peptidase 8 (USP8), transcript variant 3
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
USP8 MS Standard C13 and N15-labeled recombinant protein (NP_005145)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
USP8 MS Standard C13 and N15-labeled recombinant protein (NP_001122082)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
USP8 MS Standard C13 and N15-labeled recombinant protein (NP_001122083)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
USP8 (GFP-tagged) - Human ubiquitin specific peptidase 8 (USP8), transcript variant 4
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
USP8 (untagged)-Human ubiquitin specific peptidase 8 (USP8), transcript variant 3
Vector | pCMV6 series |
Tag | Tag Free |
USP8 (untagged) - Human ubiquitin specific peptidase 8 (USP8), transcript variant 4
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression of USP8 (NM_005154) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of USP8 (NM_001128610) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of USP8 (NM_001128611) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of USP8 (NM_001283049) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of USP8 (NM_005154) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of USP8 (NM_005154) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of USP8 (NM_001128610) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of USP8 (NM_001128610) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of USP8 (NM_001128611) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of USP8 (NM_001128611) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of USP8 (NM_001283049) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack