Products

cDNA Clones (16)
Proteins (10)
Antibodies (2)
Jump to Filters
View as table Download
Pyrin (MEFV) (NM_000243) Human Tagged ORF Clone
RC210934

USD 420.00

In Stock

MEFV (Myc-DDK-tagged)-Human Mediterranean fever (MEFV), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Pyrin (MEFV) (NM_000243) Human Tagged ORF Clone
RG210934

USD 460.00

In Stock

MEFV (GFP-tagged) - Human Mediterranean fever (MEFV), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Pyrin (MEFV) (NM_001198536) Human Tagged ORF Clone
RG231238

USD 460.00

In Stock

MEFV (GFP-tagged) - Human Mediterranean fever (MEFV), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Pyrin (MEFV) (NM_001198536) Human Tagged ORF Clone
RC231238

USD 420.00

In Stock

MEFV (Myc-DDK-tagged)-Human Mediterranean fever (MEFV), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Pyrin (MEFV) (NM_000243) Human Tagged ORF Clone
RC210934L3

USD 620.00

3 Weeks

Lenti-ORF clone of MEFV (Myc-DDK-tagged)-Human Mediterranean fever (MEFV), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Pyrin (MEFV) (NM_000243) Human Tagged ORF Clone
RC210934L4

USD 620.00

In Stock

Lenti-ORF clone of MEFV (mGFP-tagged)-Human Mediterranean fever (MEFV), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Pyrin (MEFV) (NM_001198536) Human Tagged ORF Clone
RC231238L3

USD 620.00

3 Weeks

Lenti ORF clone of Human Mediterranean fever (MEFV), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Pyrin (MEFV) (NM_001198536) Human Tagged ORF Clone
RC231238L4

USD 620.00

3 Weeks

Lenti ORF clone of Human Mediterranean fever (MEFV), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Pyrin (MEFV) (NM_000243) Human Over-expression Lysate
LY424850

USD 396.00

In Stock

Transient overexpression lysate of Mediterranean fever (MEFV)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Pyrin (MEFV) (NM_000243) Human Untagged Clone
SC300033

USD 760.00

In Stock

MEFV (untagged)-Human Mediterranean fever (MEFV), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
Pyrin (MEFV) (NM_000243) Human Tagged ORF Clone
RC210934L2

USD 620.00

3 Weeks

Lenti-ORF clone of MEFV (mGFP-tagged)-Human Mediterranean fever (MEFV), transcript variant 1

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
Pyrin (MEFV) Rabbit Polyclonal Antibody
TA329750

USD 310.00

5 Days

Rabbit Polyclonal Anti-MEFV Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MEFV antibody: synthetic peptide directed towards the N terminal of human MEFV. Synthetic peptide located within the following region: TPSDHLLSTLEELVPYDFEKFKFKLQNTSVQKEHSRIPRSQIQRARPVKM
Pyrin (MEFV) (NM_000243) Human Recombinant Protein
TP761997

USD 215.00

In Stock

Purified recombinant protein of Human Mediterranean fever (MEFV), transcript variant 1,Met1-Asn130, with N-terminal GST tag, expressed in E. coli, 50ug

Tag N-GST
Expression Host E. coli
Pyrin (MEFV) Rabbit Polyclonal Antibody
TA335166

USD 375.00

5 Days

Rabbit Polyclonal Anti-MEFV Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-MEFV antibody: synthetic peptide directed towards the N terminal of human MEFV. Synthetic peptide located within the following region: MAKTPSDHLLSTLEELVPYDFEKFKFKLQNTSVQKEHSRIPRSQIQRARP
Pyrin (MEFV) (NM_000243) Human Over-expression Lysate
LC424850

USD 121.00

2 Weeks

MEFV HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Pyrin (MEFV) ICC Control Block
TB410934

USD 1,070.00

4 Weeks

Transient overexpression of MEFV (NM_000243) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Pyrin (MEFV) ICC Control Block
TB431238

USD 1,070.00

4 Weeks

Transient overexpression of MEFV (NM_001198536) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Pyrin (MEFV) (NM_000243) Human Recombinant Protein
TP762511

USD 261.00

2 Weeks

Purified recombinant protein of Human Mediterranean fever (MEFV), transcript variant 1, full length, 50ug

Tag N-His
Expression Host E. coli
Pyrin (MEFV) Cytosection
TS410934

USD 225.00

4 Weeks

Transient overexpression of MEFV (NM_000243) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Pyrin (MEFV) Cytosection
TS410934P5

USD 889.00

4 Weeks

Transient overexpression of MEFV (NM_000243) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Pyrin (MEFV) Cytosection
TS431238

USD 225.00

4 Weeks

Transient overexpression of MEFV (NM_001198536) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Pyrin (MEFV) Cytosection
TS431238P5

USD 889.00

4 Weeks

Transient overexpression of MEFV (NM_001198536) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack