GTF2H1 (Myc-DDK-tagged)-Human general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GTF2H1 (Myc-DDK-tagged)-Human general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GTF2H1 (Myc-DDK-tagged)-Human general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, GTF2H1 (Myc-DDK tagged) - Human general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, GTF2H1 (mGFP-tagged) - Human general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
GTF2H1 (GFP-tagged) - Human general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF clone of Human general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GTF2H1 (Myc-DDK tagged) - Human general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GTF2H1 (mGFP-tagged) - Human general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 2, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GTF2H1 (Myc-DDK tagged) - Human general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 2, mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GTF2H1 (mGFP-tagged) - Human general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
GTF2H1 (GFP-tagged) - Human general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 1, Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
GTF2H1 (untagged)-Human general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 1
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Rabbit polyclonal anti-TF2H1 antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human TF2H1. |
Lenti ORF clone of Human general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 1, mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Mouse Monoclonal GTF2H1 Antibody
Applications | IF, IP, WB |
Reactivities | Human |
Conjugation | Unconjugated |
GTF2H1 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse |
GTF2H1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 1
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit Polyclonal Anti-GTF2H1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GTF2H1 antibody: synthetic peptide directed towards the N terminal of human GTF2H1. Synthetic peptide located within the following region: EEVLLIVKKVRQKKQDGALYLMAERIAWAPEGKDRFTISHMYADIKCQKI |
Rabbit Polyclonal Anti-GTF2H1 Antibody
Applications | WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-GTF2H1 antibody: synthetic peptide directed towards the middle region of human GTF2H1. Synthetic peptide located within the following region: ERFQVTKLCPFQEKIRRQYLSTNLVSHIEEMLQTAYNKLHTWQSRRLMKK |
GTF2H1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
GTF2H1 MS Standard C13 and N15-labeled recombinant protein (NP_005307)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
GTF2H1 (untagged)-Human general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Transient overexpression of GTF2H1 (NM_005316) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GTF2H1 (NM_001142307) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GTF2H1 (NM_005316) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GTF2H1 (NM_005316) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of GTF2H1 (NM_001142307) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GTF2H1 (NM_001142307) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack