Products

cDNA Clones (18)
Proteins (12)
Antibodies (5)
Jump to Filters
View as table Download
GTF2H1 (NM_005316) Human Tagged ORF Clone
RC201341

USD 480.00

In Stock

GTF2H1 (Myc-DDK-tagged)-Human general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
GTF2H1 (NM_001142307) Human Tagged ORF Clone
RC227747

USD 480.00

In Stock

GTF2H1 (Myc-DDK-tagged)-Human general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
GTF2H1 (NM_005316) Human Tagged ORF Clone Lentiviral Particle
RC201341L1V

USD 880.00

3 Weeks

Lenti ORF particles, GTF2H1 (Myc-DDK tagged) - Human general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®
GTF2H1 (NM_005316) Human Tagged ORF Clone Lentiviral Particle
RC201341L2V

USD 880.00

6 Weeks

Lenti ORF particles, GTF2H1 (mGFP-tagged) - Human general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®
GTF2H1 (NM_005316) Human Tagged ORF Clone
RG201341

USD 530.00

In Stock

GTF2H1 (GFP-tagged) - Human general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GTF2H1 (NM_005316) Human Tagged ORF Clone
RC201341L3

USD 680.00

3 Weeks

Lenti ORF clone of Human general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GTF2H1 (NM_005316) Human Tagged ORF Clone Lentiviral Particle
RC201341L3V

USD 880.00

5 Weeks

Lenti ORF particles, GTF2H1 (Myc-DDK tagged) - Human general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GTF2H1 (NM_005316) Human Tagged ORF Clone
RC201341L4

USD 680.00

3 Weeks

Lenti ORF clone of Human general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GTF2H1 (NM_005316) Human Tagged ORF Clone Lentiviral Particle
RC201341L4V

USD 880.00

7 Weeks

Lenti ORF particles, GTF2H1 (mGFP-tagged) - Human general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GTF2H1 (NM_001142307) Human Tagged ORF Clone
RC227747L3

USD 680.00

3 Weeks

Lenti ORF clone of Human general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GTF2H1 (NM_001142307) Human Tagged ORF Clone Lentiviral Particle
RC227747L3V

USD 880.00

6 Weeks

Lenti ORF particles, GTF2H1 (Myc-DDK tagged) - Human general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
GTF2H1 (NM_001142307) Human Tagged ORF Clone
RC227747L4

USD 680.00

3 Weeks

Lenti ORF clone of Human general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GTF2H1 (NM_001142307) Human Tagged ORF Clone Lentiviral Particle
RC227747L4V

USD 880.00

6 Weeks

Lenti ORF particles, GTF2H1 (mGFP-tagged) - Human general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
GTF2H1 (NM_001142307) Human Tagged ORF Clone
RG227747

USD 530.00

3 Weeks

GTF2H1 (GFP-tagged) - Human general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
GTF2H1 (NM_005316) Human Tagged ORF Clone
RC201341L1

USD 840.00

In Stock

Lenti ORF clone of Human general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®
GTF2H1 (NM_005316) Human Untagged Clone
SC116821

USD 310.00

In Stock

GTF2H1 (untagged)-Human general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 1

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None
GTF2H1 Rabbit Polyclonal Antibody
TA313983

USD 345.00

In Stock

Rabbit polyclonal anti-TF2H1 antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from N-terminal of human TF2H1.
GTF2H1 (NM_005316) Human Tagged ORF Clone
RC201341L2

USD 680.00

3 Weeks

Lenti ORF clone of Human general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®
GTF2H1 Mouse Monoclonal Antibody [Clone ID: 3E8-D3-H8]
TA346957

USD 380.00

4 Weeks

Mouse Monoclonal GTF2H1 Antibody

Applications IF, IP, WB
Reactivities Human
Conjugation Unconjugated
GTF2H1 Rabbit Polyclonal Antibody
AP20413PU-N

USD 370.00

2 Weeks

GTF2H1 rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human, Mouse
GTF2H1 (NM_001142307) Human Over-expression Lysate
LC428028

USD 121.00

In Stock

GTF2H1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GTF2H1 (NM_005316) Human Over-expression Lysate
LY417388

USD 396.00

In Stock

Transient overexpression lysate of general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GTF2H1 Rabbit Polyclonal Antibody
TA330081

USD 310.00

5 Days

Rabbit Polyclonal Anti-GTF2H1 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GTF2H1 antibody: synthetic peptide directed towards the N terminal of human GTF2H1. Synthetic peptide located within the following region: EEVLLIVKKVRQKKQDGALYLMAERIAWAPEGKDRFTISHMYADIKCQKI
GTF2H1 Rabbit Polyclonal Antibody
TA330140

USD 375.00

5 Days

Rabbit Polyclonal Anti-GTF2H1 Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-GTF2H1 antibody: synthetic peptide directed towards the middle region of human GTF2H1. Synthetic peptide located within the following region: ERFQVTKLCPFQEKIRRQYLSTNLVSHIEEMLQTAYNKLHTWQSRRLMKK
GTF2H1 (NM_005316) Human Over-expression Lysate
LC417388

USD 121.00

2 Weeks

GTF2H1 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GTF2H1 (NM_001142307) Human Over-expression Lysate
LY428028

USD 396.00

5 Days

Transient overexpression lysate of general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
GTF2H1 (NM_005316) Human Mass Spec Standard
PH301341

USD 2,055.00

3 Weeks

GTF2H1 MS Standard C13 and N15-labeled recombinant protein (NP_005307)

Tag C-Myc/DDK
Expression Host HEK293
GTF2H1 (NM_001142307) Human Untagged Clone
SC325189

USD 760.00

3 Weeks

GTF2H1 (untagged)-Human general transcription factor IIH, polypeptide 1, 62kDa (GTF2H1), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
GTF2H1 ICC Control Block
TB401341

USD 1,130.00

4 Weeks

Transient overexpression of GTF2H1 (NM_005316) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GTF2H1 ICC Control Block
TB427747

USD 1,130.00

4 Weeks

Transient overexpression of GTF2H1 (NM_001142307) in HEK293T cells paraffin embedded controls for ICC/IHC staining

GTF2H1 Cytosection
TS401341

USD 225.00

4 Weeks

Transient overexpression of GTF2H1 (NM_005316) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

GTF2H1 Cytosection
TS401341P5

USD 889.00

4 Weeks

Transient overexpression of GTF2H1 (NM_005316) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

GTF2H1 Cytosection
TS427747

USD 225.00

4 Weeks

Transient overexpression of GTF2H1 (NM_001142307) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

GTF2H1 Cytosection
TS427747P5

USD 889.00

4 Weeks

Transient overexpression of GTF2H1 (NM_001142307) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack