Products

cDNA Clones (17)
Proteins (11)
Antibodies (7)
Jump to Filters
View as table Download
Retinoid X Receptor gamma (RXRG) (NM_006917) Human Tagged ORF Clone
RG204093

USD 460.00

In Stock

RXRG (GFP-tagged) - Human retinoid X receptor, gamma (RXRG), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Retinoid X Receptor gamma (RXRG) (NM_006917) Human Tagged ORF Clone Lentiviral Particle
RC204093L3V

USD 820.00

5 Weeks

Lenti ORF particles, RXRG (Myc-DDK tagged) - Human retinoid X receptor, gamma (RXRG), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Retinoid X Receptor gamma (RXRG) (NM_006917) Human Tagged ORF Clone Lentiviral Particle
RC204093L4V

USD 820.00

3 Weeks

Lenti ORF particles, RXRG (mGFP-tagged) - Human retinoid X receptor, gamma (RXRG), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Retinoid X Receptor gamma (RXRG) (NM_001256570) Human Tagged ORF Clone
RC233817

USD 420.00

5 Weeks

RXRG (Myc-DDK tagged) - Homo sapiens retinoid X receptor, gamma (RXRG), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Retinoid X Receptor gamma (RXRG) (NM_001256571) Human Tagged ORF Clone
RC233818

USD 420.00

5 Weeks

RXRG (Myc-DDK tagged) - Homo sapiens retinoid X receptor, gamma (RXRG), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Retinoid X Receptor gamma (RXRG) (NM_006917) Human Untagged Clone
SC319914

USD 760.00

In Stock

RXRG (untagged)-Human retinoid X receptor, gamma (RXRG), transcript variant 1

Vector pCMV6-AC
Tag Tag Free
Mammalian Cell Selection Neomycin
Retinoid X Receptor gamma (RXRG) Rabbit Polyclonal Antibody
TA312331

USD 345.00

In Stock

Rabbit polyclonal Retinoid X Receptor gamma antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human Retinoid X Receptor ? antibody.
Retinoid X Receptor gamma (RXRG) Rabbit Polyclonal Antibody
TA343644

USD 410.00

5 Days

Rabbit Polyclonal Anti-RXRG Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-RXRG antibody: synthetic peptide directed towards the C terminal of human RXRG. Synthetic peptide located within the following region: LEAYTKQKYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDT
Retinoid X Receptor gamma (RXRG) Rabbit Polyclonal Antibody
AP06308PU-N

USD 370.00

2 Weeks

Retinoid X Receptor gamma (RXRG) rabbit polyclonal antibody, Aff - Purified

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Immunogen Synthetic peptide, corresponding to amino acids 150-250 of Human RXRγ.
Retinoid X Receptor gamma (RXRG) Goat Polyclonal Antibody
TA302595

USD 375.00

5 Days

Goat Polyclonal Antibody against RXR gamma

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence RQRSRERAESEAEC, from the internal region of the protein sequence according to NP_008848.
Retinoid X Receptor gamma (RXRG) Rabbit Polyclonal Antibody
TA338120

USD 375.00

5 Days

Rabbit Polyclonal Anti-RXRG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RXRG antibody: synthetic peptide directed towards the N terminal of human RXRG. Synthetic peptide located within the following region: NVVNSVSSSEDIKPLPGLPGIGNMNYPSTSPGSLVKHICAICGDRSSGKH
Retinoid X Receptor gamma (RXRG) Rabbit Polyclonal Antibody
TA339141

USD 310.00

5 Days

Rabbit Polyclonal Anti-RXRG Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-RXRG antibody: synthetic peptide directed towards the N terminal of human RXRG. Synthetic peptide located within the following region: GSPYRVITSAMGPPSGALAAPPGINLVAPPSSQLNVVNSVSSSEDIKPLP
Retinoid X Receptor gamma (RXRG) (NM_006917) Human Over-expression Lysate
LY402059

USD 396.00

5 Days

Transient overexpression lysate of retinoid X receptor, gamma (RXRG), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
Retinoid X Receptor gamma (RXRG) (NM_006917) ICC Control Block
TB404093

USD 1,070.00

4 Weeks

Transient overexpression of RXRG (NM_006917) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Retinoid X Receptor gamma (RXRG) (NM_001256570) ICC Control Block
TB433817

USD 1,070.00

4 Weeks

Transient overexpression of RXRG (NM_001256570) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Retinoid X Receptor gamma (RXRG) (NM_001256571) ICC Control Block
TB433818

USD 1,070.00

4 Weeks

Transient overexpression of RXRG (NM_001256571) in HEK293T cells paraffin embedded controls for ICC/IHC staining

Retinoid X Receptor gamma (RXRG) Cytosection
TS404093

USD 225.00

4 Weeks

Transient overexpression of RXRG (NM_006917) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

Retinoid X Receptor gamma (RXRG) Cytosection
TS404093P5

USD 889.00

4 Weeks

Transient overexpression of RXRG (NM_006917) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Retinoid X Receptor gamma (RXRG) ICC Control Sections
TS433817P5

USD 889.00

4 Weeks

Transient overexpression of RXRG (NM_001256570) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

Retinoid X Receptor gamma (RXRG) ICC Control Sections
TS433818P5

USD 889.00

4 Weeks

Transient overexpression of RXRG (NM_001256571) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack