PSMA2 (Myc-DDK-tagged)-Human proteasome (prosome, macropain) subunit, alpha type, 2 (PSMA2)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
PSMA2 (Myc-DDK-tagged)-Human proteasome (prosome, macropain) subunit, alpha type, 2 (PSMA2)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, PSMA2 (Myc-DDK tagged) - Human proteasome (prosome, macropain) subunit, alpha type, 2 (PSMA2), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, PSMA2 (mGFP-tagged) - Human proteasome (prosome, macropain) subunit, alpha type, 2 (PSMA2), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
PSMA2 (GFP-tagged) - Human proteasome (prosome, macropain) subunit, alpha type, 2 (PSMA2)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human proteasome (prosome, macropain) subunit, alpha type, 2 (PSMA2), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PSMA2 (Myc-DDK tagged) - Human proteasome (prosome, macropain) subunit, alpha type, 2 (PSMA2), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human proteasome (prosome, macropain) subunit, alpha type, 2 (PSMA2), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, PSMA2 (mGFP-tagged) - Human proteasome (prosome, macropain) subunit, alpha type, 2 (PSMA2), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Rabbit anti-PSMA2 Polyclonal Antibody
Applications | ICC/IF, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human PSMA2 |
Lenti ORF clone of Human proteasome (prosome, macropain) subunit, alpha type, 2 (PSMA2), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
PSMA2 (untagged)-Human proteasome (prosome, macropain) subunit, alpha type, 2 (PSMA2)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human proteasome (prosome, macropain) subunit, alpha type, 2 (PSMA2), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit Polyclonal antibody to Proteasome 20S alpha 2 (proteasome (prosome, macropain) subunit, alpha type, 2)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 1 and 234 of Proteasome 20S alpha 2 (Uniprot ID#P25787) |
PSMA2 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit polyclonal Anti-PSMA2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PSMA2 antibody: synthetic peptide directed towards the N terminal of human PSMA2. Synthetic peptide located within the following region: VGIKAANGVVLATEKKQKSILYDERSVHKVEPITKHIGLVYSGMGPDYRV |
PSMA2 (1-234, His-tag) human recombinant protein, 0.5 mg
Tag | His-tag |
Expression Host | E. coli |
PSMA2 (1-234, His-tag) human recombinant protein, 0.1 mg
Tag | His-tag |
Expression Host | E. coli |
Carrier-free (BSA/glycerol-free) PSMA2 mouse monoclonal antibody, clone OTI1E1 (formerly 1E1)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PSMA2 mouse monoclonal antibody, clone OTI4D12 (formerly 4D12)
Applications | WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PSMA2 mouse monoclonal antibody, clone OTI3B3 (formerly 3B3)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PSMA2 mouse monoclonal antibody, clone OTI3E9 (formerly 3E9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PSMA2 mouse monoclonal antibody, clone OTI3E2 (formerly 3E2)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PSMA2 mouse monoclonal antibody, clone OTI3H8 (formerly 3H8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PSMA2 mouse monoclonal antibody, clone OTI3D9 (formerly 3D9)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
Transient overexpression lysate of proteasome (prosome, macropain) subunit, alpha type, 2 (PSMA2)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
PSMA2 (Proteasome 20S alpha 2) mouse monoclonal antibody, clone OTI1E1 (formerly 1E1)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PSMA2 mouse monoclonal antibody,clone 1E1, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PSMA2 mouse monoclonal antibody,clone 1E1, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PSMA2 (Proteasome 20S alpha 2) mouse monoclonal antibody, clone OTI1E1 (formerly 1E1)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PSMA2 (Proteasome 20S alpha 2) mouse monoclonal antibody, clone OTI4D12 (formerly 4D12)
Applications | WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
USD 420.00
5 Days
PSMA2 mouse monoclonal antibody,clone 4D12, Biotinylated
Applications | WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Biotin |
PSMA2 mouse monoclonal antibody,clone 4D12, HRP conjugated
Applications | WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | HRP |
PSMA2 (Proteasome 20S alpha 2) mouse monoclonal antibody, clone OTI4D12 (formerly 4D12)
Applications | WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
PSMA2 (Proteasome 20S alpha 2) mouse monoclonal antibody, clone OTI3B3 (formerly 3B3)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
PSMA2 mouse monoclonal antibody,clone 3B3, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Biotin |
PSMA2 mouse monoclonal antibody,clone 3B3, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | HRP |
PSMA2 (Proteasome 20S alpha 2) mouse monoclonal antibody, clone OTI3B3 (formerly 3B3)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |
PSMA2 (Proteasome 20S alpha 2) mouse monoclonal antibody, clone OTI3E9 (formerly 3E9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PSMA2 mouse monoclonal antibody,clone 3E9, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PSMA2 mouse monoclonal antibody,clone 3E9, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PSMA2 (Proteasome 20S alpha 2) mouse monoclonal antibody, clone OTI3E9 (formerly 3E9)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PSMA2 (Proteasome 20S alpha 2) mouse monoclonal antibody, clone OTI3E2 (formerly 3E2)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PSMA2 mouse monoclonal antibody,clone 3E2, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PSMA2 mouse monoclonal antibody,clone 3E2, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PSMA2 (Proteasome 20S alpha 2) mouse monoclonal antibody, clone OTI3E2 (formerly 3E2)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PSMA2 (Proteasome 20S alpha 2) mouse monoclonal antibody, clone OTI3H8 (formerly 3H8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PSMA2 mouse monoclonal antibody,clone 3H8, Biotinylated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PSMA2 mouse monoclonal antibody,clone 3H8, HRP conjugated
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PSMA2 (Proteasome 20S alpha 2) mouse monoclonal antibody, clone OTI3H8 (formerly 3H8)
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PSMA2 (Proteasome 20S alpha 2) mouse monoclonal antibody, clone OTI3D9 (formerly 3D9)
Applications | IHC, WB |
Reactivities | Human, Monkey, Mouse, Rat, Dog |
Conjugation | Unconjugated |