GIT1 (Myc-DDK-tagged)-Human G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
- TrueORF®
GIT1 (Myc-DDK-tagged)-Human G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GIT1 (Myc-DDK-tagged)-Human G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1), transcript variant 1
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
GIT1 (GFP-tagged) - Human G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti-ORF clone of GIT1 (Myc-DDK-tagged)-Human G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1), transcript variant 2
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GIT1 (Myc-DDK-tagged)-Human G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of GIT1 (mGFP-tagged)-Human G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1), transcript variant 2
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GIT1 (mGFP-tagged)-Human G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1), transcript variant 2, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of GIT1 (Myc-DDK-tagged)-Human G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1), transcript variant 1
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GIT1 (Myc-DDK-tagged)-Human G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti-ORF clone of GIT1 (mGFP-tagged)-Human G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1), transcript variant 1
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, GIT1 (mGFP-tagged)-Human G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1), transcript variant 1, 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
GIT1 (GFP-tagged) - Human G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1), transcript variant 1
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Rabbit polyclonal GIT1 antibody
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from C-terminal of human GIT1. |
Rabbit Polyclonal Anti-GIT1 Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-Git1 antibody is: synthetic peptide directed towards the middle region of Rat Git1. Synthetic peptide located within the following region: PLLSSSQEGSRHASKLSRHGSGAESDYENTQSGEPLLGLEGKRFLELSKE |
GIT1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Transient overexpression lysate of G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1), transcript variant 2
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
GIT1 MS Standard C13 and N15-labeled recombinant protein (NP_054749)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
GIT1 (untagged)-Human G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1), transcript variant 2
Vector | pCMV6 series |
Tag | Tag Free |
GIT1 (untagged)-Human G protein-coupled receptor kinase interacting ArfGAP 1 (GIT1), transcript variant 1
Vector | pCMV6 series |
Tag | Tag Free |
Transient overexpression of GIT1 (NM_014030) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GIT1 (NM_001085454) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of GIT1 (NM_014030) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GIT1 (NM_014030) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack
Transient overexpression of GIT1 (NM_001085454) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of GIT1 (NM_001085454) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack