UGT1A9 (Myc-DDK-tagged)-Human UDP glucuronosyltransferase 1 family, polypeptide A9 (UGT1A9)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
UGT1A9 (Myc-DDK-tagged)-Human UDP glucuronosyltransferase 1 family, polypeptide A9 (UGT1A9)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, UGT1A9 (Myc-DDK tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A9 (UGT1A9), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, UGT1A9 (mGFP-tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A9 (UGT1A9), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
UGT1A9 (GFP-tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A9 (UGT1A9)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human UDP glucuronosyltransferase 1 family, polypeptide A9 (UGT1A9), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, UGT1A9 (Myc-DDK tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A9 (UGT1A9), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human UDP glucuronosyltransferase 1 family, polypeptide A9 (UGT1A9), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, UGT1A9 (mGFP-tagged) - Human UDP glucuronosyltransferase 1 family, polypeptide A9 (UGT1A9), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
UGT1A9 (untagged)-Human UDP glucuronosyltransferase 1 family, polypeptide A9 (UGT1A9)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human UDP glucuronosyltransferase 1 family, polypeptide A9 (UGT1A9), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit Polyclonal antibody to UGT1A9 (UDP glucuronosyltransferase 1 family, polypeptide A9)
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fragment corresponding to a region within amino acids 291 and 530 of UGT1A9 (Uniprot ID#O60656) |
UGT1A9 Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant protein of human UGT1A9 |
Transient overexpression lysate of UDP glucuronosyltransferase 1 family, polypeptide A9 (UGT1A9)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human UDP glucuronosyltransferase 1 family, polypeptide A9 (UGT1A9), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
UGT1A9 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Purified recombinant protein of Human UDP glucuronosyltransferase 1 family, polypeptide A9 (UGT1A9), full length, with N-terminal GST and C-terminal His tag, expressed in E. coli, 50ug
Tag | N-GST and C-His |
Expression Host | E. coli |
Rabbit Polyclonal anti-UGT1A9 antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-UGT1A9 antibody: synthetic peptide directed towards the N terminal of human UGT1A9. Synthetic peptide located within the following region: LLMGSYNDIFDLFFSNCRSLFKDKKLVEYLKESSFDAVFLDPFDNCGLIV |
Transient overexpression of UGT1A9 (NM_021027) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of UGT1A9 (NM_021027) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of UGT1A9 (NM_021027) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack