ULK1 (Myc-DDK-tagged)-Human unc-51-like kinase 1 (C. elegans) (ULK1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ULK1 (Myc-DDK-tagged)-Human unc-51-like kinase 1 (C. elegans) (ULK1)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, ULK1 (Myc-DDK tagged) - Human unc-51-like kinase 1 (C. elegans) (ULK1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, ULK1 (mGFP-tagged) - Human unc-51-like kinase 1 (C. elegans) (ULK1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
ULK1 (GFP-tagged) - Human unc-51-like kinase 1 (C. elegans) (ULK1)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
Lenti ORF particles, ULK1 (Myc-DDK tagged) - Human unc-51-like kinase 1 (C. elegans) (ULK1), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human unc-51-like kinase 1 (C. elegans) (ULK1), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ULK1 (mGFP-tagged) - Human unc-51-like kinase 1 (C. elegans) (ULK1), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
ULK1 (untagged)-Human unc-51-like kinase 1 (C. elegans) (ULK1)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Lenti ORF clone of Human unc-51-like kinase 1 (C. elegans) (ULK1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF clone of Human unc-51-like kinase 1 (C. elegans) (ULK1), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Transient overexpression lysate of unc-51-like kinase 1 (C. elegans) (ULK1)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit polyclonal APG1 (ULK1) Antibody (Center)
Applications | IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This APG1 (ULK1) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 642-672 amino acids from the Central region of human APG1 (ULK1). |
Rabbit Polyclonal ULK1 Antibody
Applications | IF, IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | ULK1 antibody was raised against a 16 amino acid peptide near the center of human ULK1 . |
ULK1 rabbit polyclonal antibody, Purified
Applications | FC, IHC, WB |
Reactivities | Human, Mouse |
Immunogen | KLH conjugated synthetic peptide selected from Human Unc-51-like kinase 1 (ULK1) |
ULK1 HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Lenti ORF clone of Human unc-51-like kinase 1 (C. elegans) (ULK1), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit Polyclonal ULK1 Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Primate |
Conjugation | Unconjugated |
Immunogen | A synthetic peptide corresponding to amino acids between 320 and 370 of human ULK1 was used as the immunogen, GenBank no. sp O75385.2 ULK1_HUMAN. |
Rabbit Polyclonal Anti-ULK1 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ULK1 Antibody is: synthetic peptide directed towards the N-terminal region of Human ULK1. Synthetic peptide located within the following region: PEVIMSQHYDGKADLWSIGTIVYQCLTGKAPFQASSPQDLRLFYEKNKTL |
ULK1 MS Standard C13 and N15-labeled recombinant protein (NP_003556)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
Transient overexpression of ULK1 (NM_003565) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ULK1 (NM_003565) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ULK1 (NM_003565) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack