Products

View as table Download

Mouse monoclonal Hsp90 Antibody

Applications IHC
Reactivities Human, Rabbit, Rat, Mouse, Chicken, Achyla, Wheat Germ, Sf9 cell line
Conjugation Unconjugated

Rabbit Polyclonal Anti-GABARAP

Applications WB
Reactivities Human, Manducasexta
Conjugation Unconjugated
Immunogen The immunogen for anti-GABARAP antibody: synthetic peptide directed towards the N terminal of human GABARAP. Synthetic peptide located within the following region: IRKKYPDRVPVIVEKAPKARIGDLDKKKYLVPSDLTVGQFYFLIRKRIHL

Mouse monoclonal Anti-PCNA Clone PC10

Reactivities Human, Insect, Saccharomyces pombe
Conjugation Unconjugated