Germany
Japan
United Kingdom
China
Products
Rabbit Polyclonal Anti-MFI2 Antibody
| Applications | IF, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-MFI2 antibody: synthetic peptide directed towards the C terminal of human MFI2. Synthetic peptide located within the following region: CVPVNNPKNYPSSLCALCVGDEQGRNKCVGNSQERYYGYRGAFRCLVENA |
MFI2 / Melanotransferrin Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Bat, Gibbon, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Rat |
| Immunogen | MFI2 / p97 / Melanotransferrin antibody was raised against synthetic 15 amino acid peptide from N-terminus of human MFI2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bat, Hamster, Elephant, Panda, Horse (100%); Bovine, Rabbit, Pig (93%); Chicken, Platypus (87%); Dog, Turkey, Medaka, Zebrafish (80%). |
MFI2 / Melanotransferrin Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Human |
| Immunogen | MFI2 / p97 / Melanotransferrin antibody was raised against synthetic 20 amino acid peptide from N-terminus of human MFI2. Percent identity with other species by BLAST analysis: Human (100%); Gorilla (95%); Gibbon (85%). |
MFI2 / Melanotransferrin Rabbit Polyclonal (N-Terminus) Antibody
| Applications | IHC |
| Reactivities | Gibbon, Dog, Gorilla, Horse, Human, Monkey, Mouse, Rabbit |
| Conjugation | Unconjugated |
| Immunogen | MFI2 / p97 / Melanotransferrin antibody was raised against synthetic 15 amino acid peptide from N-terminus of human MFI2. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Marmoset, Mouse, Dog, Elephant, Panda, Horse, Rabbit (100%); Bovine, Hamster, Pig (93%); Rat, Turkey, Chicken, Platypus (87%). |
Active filters
Category
-
Antibodies
- Primary Antibodies
Target Symbol
- MELTF
Families
- Druggable Genome