Germany
Japan
United Kingdom
China
ADH1B (Myc-DDK-tagged)-Human alcohol dehydrogenase 1B (class I), beta polypeptide (ADH1B)
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
Products
View as table Download
Recombinant protein of human alcohol dehydrogenase 1B (class I), beta polypeptide (ADH1B)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, ADH1B (Myc-DDK tagged) - Human alcohol dehydrogenase 1B (class I), beta polypeptide (ADH1B), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
- LentiORF®
-
Lenti ORF particles, ADH1B (mGFP-tagged) - Human alcohol dehydrogenase 1B (class I), beta polypeptide (ADH1B), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
- LentiORF®
-
Lenti ORF clone of Human alcohol dehydrogenase 1B (class I), beta polypeptide (ADH1B), mGFP tagged
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
ADH1B (GFP-tagged) - Human alcohol dehydrogenase 1B (class I), beta polypeptide (ADH1B)
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human alcohol dehydrogenase 1B (class I), beta polypeptide (ADH1B), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
Lenti ORF particles, ADH1B (Myc-DDK tagged) - Human alcohol dehydrogenase 1B (class I), beta polypeptide (ADH1B), 200ul, >10^7 TU/mL
| Vector | pLenti-C-Myc-DDK-P2A-Puro |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
Lenti ORF particles, ADH1B (mGFP-tagged) - Human alcohol dehydrogenase 1B (class I), beta polypeptide (ADH1B), 200ul, >10^7 TU/mL
| Vector | pLenti-C-mGFP-P2A-Puro |
| Tag | mGFP |
| Mammalian Cell Selection | Puromycin |
- LentiORF®
-
ADH1B (myc-DDK-tagged) - Human alcohol dehydrogenase 1B (class I), beta polypeptide (ADH1B), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Myc-DDK |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
Lenti ORF clone of Human alcohol dehydrogenase 1B (class I), beta polypeptide (ADH1B), Myc-DDK-tagged
| Vector | pLenti-C-Myc-DDK |
| Tag | Myc-DDK |
| Mammalian Cell Selection | None |
- LentiORF®
Rabbit Polyclonal Anti-ADH1B Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADH1B antibody: synthetic peptide directed towards the C terminal of human ADH1B. Synthetic peptide located within the following region: NLSINPMLLLTGRTWKGAVYGGFKSKEGIPKLVADFMAKKFSLDALITHV |
ADH1B (untagged)-Human alcohol dehydrogenase 1B (class I), beta polypeptide (ADH1B)
| Vector | pCMV6-XL5 |
| Tag | Tag Free |
| Mammalian Cell Selection | None |
ADH1B HEK293T cell transient overexpression lysate (as WB positive control)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
Rabbit polyclonal ADH1B Antibody (Center)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This ADH1B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 209-237 amino acids from the Central region of human ADH1B. |
Rabbit Polyclonal Anti-ADH1B Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-ADH1B antibody: synthetic peptide directed towards the N terminal of human ADH1B. Synthetic peptide located within the following region: STAGKVIKCKAAVLWEVKKPFSIEDVEVAPPKAYEVRIKMVAVGICHTDD |
Lenti ORF clone of Human alcohol dehydrogenase 1B (class I), beta polypeptide (ADH1B), mGFP tagged
| Vector | pLenti-C-mGFP |
| Tag | mGFP |
| Mammalian Cell Selection | None |
- LentiORF®
ADH1B (untagged) - Human alcohol dehydrogenase 1B (class I), beta polypeptide (ADH1B), transcript variant 2
| Vector | pCMV6-Entry |
| Tag | Tag Free |
| Mammalian Cell Selection | Neomycin |
Carrier-free (BSA/glycerol-free) ADH1B mouse monoclonal antibody, clone OTI4F12 (formerly 4F12)
| Applications | FC, IF, IHC, WB |
| Reactivities | Human, Rat, Dog |
| Conjugation | Unconjugated |
Transient overexpression lysate of alcohol dehydrogenase 1B (class I), beta polypeptide (ADH1B)
| Tag | C-Myc/DDK |
| Expression Host | HEK293T |
| Applications | WB |
ADH1B MS Standard C13 and N15-labeled recombinant protein (NP_000659)
| Tag | C-Myc/DDK |
| Expression Host | HEK293 |
ADH1B (GFP-tagged) - Human alcohol dehydrogenase 1B (class I), beta polypeptide (ADH1B), transcript variant 2
| Vector | pCMV6-AC-GFP |
| Tag | TurboGFP |
| Mammalian Cell Selection | Neomycin |
- TrueORF®
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
USD 420.00
4 Weeks
Active filters
Target Symbol
- ADH1B
Families
- Druggable Genome