ADH1B (Myc-DDK-tagged)-Human alcohol dehydrogenase 1B (class I), beta polypeptide (ADH1B)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
ADH1B (Myc-DDK-tagged)-Human alcohol dehydrogenase 1B (class I), beta polypeptide (ADH1B)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Recombinant protein of human alcohol dehydrogenase 1B (class I), beta polypeptide (ADH1B)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Special Offer: Get a 20% discount on this product. Use code: "MVPro20".
Lenti ORF particles, ADH1B (Myc-DDK tagged) - Human alcohol dehydrogenase 1B (class I), beta polypeptide (ADH1B), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Lenti ORF particles, ADH1B (mGFP-tagged) - Human alcohol dehydrogenase 1B (class I), beta polypeptide (ADH1B), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
Lenti ORF clone of Human alcohol dehydrogenase 1B (class I), beta polypeptide (ADH1B), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
ADH1B (GFP-tagged) - Human alcohol dehydrogenase 1B (class I), beta polypeptide (ADH1B)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ADH1B - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.
Format | 2 gRNA vectors, 1 linear donor |
Donor DNA | EF1a-GFP-P2A-Puro |
Lenti ORF clone of Human alcohol dehydrogenase 1B (class I), beta polypeptide (ADH1B), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ADH1B (Myc-DDK tagged) - Human alcohol dehydrogenase 1B (class I), beta polypeptide (ADH1B), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
Lenti ORF particles, ADH1B (mGFP-tagged) - Human alcohol dehydrogenase 1B (class I), beta polypeptide (ADH1B), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
ADH1B (myc-DDK-tagged) - Human alcohol dehydrogenase 1B (class I), beta polypeptide (ADH1B), transcript variant 2
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
Lenti ORF clone of Human alcohol dehydrogenase 1B (class I), beta polypeptide (ADH1B), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
Mammalian Cell Selection | None |
Rabbit Polyclonal Anti-ADH1B Antibody
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ADH1B antibody: synthetic peptide directed towards the C terminal of human ADH1B. Synthetic peptide located within the following region: NLSINPMLLLTGRTWKGAVYGGFKSKEGIPKLVADFMAKKFSLDALITHV |
ADH1B (untagged)-Human alcohol dehydrogenase 1B (class I), beta polypeptide (ADH1B)
Vector | pCMV6-XL5 |
Tag | Tag Free |
Mammalian Cell Selection | None |
ADH1B HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Rabbit polyclonal ADH1B Antibody (Center)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | This ADH1B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 209-237 amino acids from the Central region of human ADH1B. |
Rabbit Polyclonal Anti-ADH1B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ADH1B antibody: synthetic peptide directed towards the N terminal of human ADH1B. Synthetic peptide located within the following region: STAGKVIKCKAAVLWEVKKPFSIEDVEVAPPKAYEVRIKMVAVGICHTDD |
Lenti ORF clone of Human alcohol dehydrogenase 1B (class I), beta polypeptide (ADH1B), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
ADH1B (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each
Purity | HPLC purified |
Number of Transfections | Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM). |
Special offer: Get $100/€100 off this product. Use code: SR100
Anti-ADH1B Rabbit Polyclonal Antibody
Applications | IHC |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 226-338 amino acids of human alcohol dehydrogenase 1B (class I), beta polypeptide |
qSTAR qPCR primer pairs against Homo sapiens gene ADH1B
Component | 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions) |
ADH1B (untagged) - Human alcohol dehydrogenase 1B (class I), beta polypeptide (ADH1B), transcript variant 2
Vector | pCMV6-Entry |
Tag | Tag Free |
Mammalian Cell Selection | Neomycin |
Carrier-free (BSA/glycerol-free) ADH1B mouse monoclonal antibody, clone OTI1C3 (formerly 1C3)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ADH1B mouse monoclonal antibody, clone OTI1H7 (formerly 1H7)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ADH1B mouse monoclonal antibody, clone OTI4F12 (formerly 4F12)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Rat, Dog |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ADH1B mouse monoclonal antibody, clone OTI5D7 (formerly 5D7)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ADH1B mouse monoclonal antibody, clone OTI3C12 (formerly 3C12)
Applications | FC, IF, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) ADH1B mouse monoclonal antibody, clone OTI3F2 (formerly 3F2)
Applications | FC, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
ADH1B CRISPRa kit - CRISPR gene activation of human alcohol dehydrogenase 1B (class I), beta polypeptide
Format | 3gRNAs, 1 scramble ctrl and 1 enhancer vector |
qPCR primer pairs and template standards against Homo sapiens gene ADH1B
Application | Plasmid of exact quantity for transcript copy number calculation |
Transient overexpression lysate of alcohol dehydrogenase 1B (class I), beta polypeptide (ADH1B)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
ADH1B MS Standard C13 and N15-labeled recombinant protein (NP_000659)
Tag | C-Myc/DDK |
Expression Host | HEK293 |
ADH1B (GFP-tagged) - Human alcohol dehydrogenase 1B (class I), beta polypeptide (ADH1B), transcript variant 2
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
3`UTR clone of alcohol dehydrogenase 1B (class I) beta polypeptide (ADH1B) for miRNA target validation
Vector | pMirTarget |
Mammalian Cell Selection | Neomycin |
Species | Human |
Transfection Reporter | RFP |
Assay Reporter | Luciferase |
Anti-ADH1B Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 226-338 amino acids of human alcohol dehydrogenase 1B (class I), beta polypeptide |
ADH1B Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Rat |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 206-375 of human ADH1B (NP_000659.2). |
Modifications | Unmodified |
ADH1B mouse monoclonal antibody, clone OTI1C3 (formerly 1C3)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ADH1B mouse monoclonal antibody, clone OTI1C3 (formerly 1C3), Biotinylated
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
ADH1B mouse monoclonal antibody, clone OTI1C3 (formerly 1C3), HRP conjugated
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
ADH1B mouse monoclonal antibody, clone OTI1C3 (formerly 1C3)
Applications | IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
ADH1B mouse monoclonal antibody, clone OTI1H7 (formerly 1H7)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ADH1B mouse monoclonal antibody, clone OTI1H7 (formerly 1H7), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Biotin |
ADH1B mouse monoclonal antibody, clone OTI1H7 (formerly 1H7), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | HRP |
ADH1B mouse monoclonal antibody, clone OTI1H7 (formerly 1H7)
Applications | FC, IF, IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
ADH1B mouse monoclonal antibody, clone OTI4F12 (formerly 4F12)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Rat, Dog |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ADH1B mouse monoclonal antibody, clone OTI4F12 (formerly 4F12), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Rat, Dog |
Conjugation | Biotin |
ADH1B mouse monoclonal antibody, clone OTI4F12 (formerly 4F12), HRP conjugated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Rat, Dog |
Conjugation | HRP |
ADH1B mouse monoclonal antibody, clone OTI4F12 (formerly 4F12)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Rat, Dog |
Conjugation | Unconjugated |
ADH1B mouse monoclonal antibody, clone OTI5D7 (formerly 5D7)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
ADH1B mouse monoclonal antibody, clone OTI5D7 (formerly 5D7), Biotinylated
Applications | FC, IF, IHC, WB |
Reactivities | Human, Monkey |
Conjugation | Biotin |