Products

View as table Download

ADH1B (Myc-DDK-tagged)-Human alcohol dehydrogenase 1B (class I), beta polypeptide (ADH1B)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin

Lenti ORF particles, ADH1B (Myc-DDK tagged) - Human alcohol dehydrogenase 1B (class I), beta polypeptide (ADH1B), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
  • LentiORF®

Lenti ORF particles, ADH1B (mGFP-tagged) - Human alcohol dehydrogenase 1B (class I), beta polypeptide (ADH1B), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP
Tag mGFP
  • LentiORF®

Lenti ORF clone of Human alcohol dehydrogenase 1B (class I), beta polypeptide (ADH1B), mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

ADH1B (GFP-tagged) - Human alcohol dehydrogenase 1B (class I), beta polypeptide (ADH1B)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

ADH1B - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN405391 is the updated version of KN205391.

Lenti ORF clone of Human alcohol dehydrogenase 1B (class I), beta polypeptide (ADH1B), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ADH1B (Myc-DDK tagged) - Human alcohol dehydrogenase 1B (class I), beta polypeptide (ADH1B), 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®

Lenti ORF particles, ADH1B (mGFP-tagged) - Human alcohol dehydrogenase 1B (class I), beta polypeptide (ADH1B), 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®

ADH1B (myc-DDK-tagged) - Human alcohol dehydrogenase 1B (class I), beta polypeptide (ADH1B), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®

Lenti ORF clone of Human alcohol dehydrogenase 1B (class I), beta polypeptide (ADH1B), Myc-DDK-tagged

Vector pLenti-C-Myc-DDK
Tag Myc-DDK
Mammalian Cell Selection None
  • LentiORF®

Rabbit Polyclonal Anti-ADH1B Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ADH1B antibody: synthetic peptide directed towards the C terminal of human ADH1B. Synthetic peptide located within the following region: NLSINPMLLLTGRTWKGAVYGGFKSKEGIPKLVADFMAKKFSLDALITHV

ADH1B (untagged)-Human alcohol dehydrogenase 1B (class I), beta polypeptide (ADH1B)

Vector pCMV6-XL5
Tag Tag Free
Mammalian Cell Selection None

ADH1B HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

Rabbit polyclonal ADH1B Antibody (Center)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen This ADH1B antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 209-237 amino acids from the Central region of human ADH1B.

Rabbit Polyclonal Anti-ADH1B Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-ADH1B antibody: synthetic peptide directed towards the N terminal of human ADH1B. Synthetic peptide located within the following region: STAGKVIKCKAAVLWEVKKPFSIEDVEVAPPKAYEVRIKMVAVGICHTDD

Lenti ORF clone of Human alcohol dehydrogenase 1B (class I), beta polypeptide (ADH1B), mGFP tagged

Vector pLenti-C-mGFP
Tag mGFP
Mammalian Cell Selection None
  • LentiORF®

ADH1B (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

Anti-ADH1B Rabbit Polyclonal Antibody

Applications IHC
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 226-338 amino acids of human alcohol dehydrogenase 1B (class I), beta polypeptide

qSTAR qPCR primer pairs against Homo sapiens gene ADH1B

Component 1 vial of lyophilized qSTAR qPCR primer mix (1 nmol each primer, sufficient for 200 reactions)

ADH1B (untagged) - Human alcohol dehydrogenase 1B (class I), beta polypeptide (ADH1B), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin

Carrier-free (BSA/glycerol-free) ADH1B mouse monoclonal antibody, clone OTI1C3 (formerly 1C3)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ADH1B mouse monoclonal antibody, clone OTI1H7 (formerly 1H7)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ADH1B mouse monoclonal antibody, clone OTI4F12 (formerly 4F12)

Applications FC, IF, IHC, WB
Reactivities Human, Rat, Dog
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ADH1B mouse monoclonal antibody, clone OTI5D7 (formerly 5D7)

Applications FC, IF, IHC, WB
Reactivities Human, Monkey
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ADH1B mouse monoclonal antibody, clone OTI3C12 (formerly 3C12)

Applications FC, IF, WB
Reactivities Human
Conjugation Unconjugated

Carrier-free (BSA/glycerol-free) ADH1B mouse monoclonal antibody, clone OTI3F2 (formerly 3F2)

Applications FC, IHC, WB
Reactivities Human
Conjugation Unconjugated

ADH1B CRISPRa kit - CRISPR gene activation of human alcohol dehydrogenase 1B (class I), beta polypeptide

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector

qPCR primer pairs and template standards against Homo sapiens gene ADH1B

Application Plasmid of exact quantity for transcript copy number calculation

Transient overexpression lysate of alcohol dehydrogenase 1B (class I), beta polypeptide (ADH1B)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB

ADH1B MS Standard C13 and N15-labeled recombinant protein (NP_000659)

Tag C-Myc/DDK
Expression Host HEK293

ADH1B (GFP-tagged) - Human alcohol dehydrogenase 1B (class I), beta polypeptide (ADH1B), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®

3`UTR clone of alcohol dehydrogenase 1B (class I) beta polypeptide (ADH1B) for miRNA target validation

Vector pMirTarget
Mammalian Cell Selection Neomycin
Species Human
Transfection Reporter RFP
Assay Reporter Luciferase

Anti-ADH1B Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 226-338 amino acids of human alcohol dehydrogenase 1B (class I), beta polypeptide

ADH1B Rabbit polyclonal Antibody

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 206-375 of human ADH1B (NP_000659.2).
Modifications Unmodified

ADH1B mouse monoclonal antibody, clone OTI1C3 (formerly 1C3)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

ADH1B mouse monoclonal antibody, clone OTI1C3 (formerly 1C3)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

ADH1B mouse monoclonal antibody, clone OTI1H7 (formerly 1H7)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

ADH1B mouse monoclonal antibody, clone OTI1H7 (formerly 1H7)

Applications FC, IF, IHC, WB
Reactivities Human
Conjugation Unconjugated

ADH1B mouse monoclonal antibody, clone OTI4F12 (formerly 4F12)

Applications FC, IF, IHC, WB
Reactivities Human, Rat, Dog
Conjugation Unconjugated

ADH1B mouse monoclonal antibody, clone OTI4F12 (formerly 4F12), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human, Rat, Dog
Conjugation Biotin

ADH1B mouse monoclonal antibody, clone OTI4F12 (formerly 4F12), HRP conjugated

Applications FC, IF, IHC, WB
Reactivities Human, Rat, Dog
Conjugation HRP

ADH1B mouse monoclonal antibody, clone OTI4F12 (formerly 4F12)

Applications FC, IF, IHC, WB
Reactivities Human, Rat, Dog
Conjugation Unconjugated

ADH1B mouse monoclonal antibody, clone OTI5D7 (formerly 5D7)

Applications FC, IF, IHC, WB
Reactivities Human, Monkey
Conjugation Unconjugated

ADH1B mouse monoclonal antibody, clone OTI5D7 (formerly 5D7), Biotinylated

Applications FC, IF, IHC, WB
Reactivities Human, Monkey
Conjugation Biotin