USD 420.00
In Stock
ADRA1B (Myc-DDK-tagged)-Human adrenergic, alpha-1B-, receptor (ADRA1B)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 420.00
In Stock
ADRA1B (Myc-DDK-tagged)-Human adrenergic, alpha-1B-, receptor (ADRA1B)
Vector | pCMV6-Entry |
Tag | Myc-DDK |
Mammalian Cell Selection | Neomycin |
USD 820.00
3 Weeks
Lenti ORF particles, ADRA1B (Myc-DDK tagged) - Human adrenergic, alpha-1B-, receptor (ADRA1B), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK |
Tag | Myc-DDK |
USD 820.00
6 Weeks
Lenti ORF particles, ADRA1B (mGFP-tagged) - Human adrenergic, alpha-1B-, receptor (ADRA1B), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP |
Tag | mGFP |
USD 620.00
3 Weeks
Lenti ORF clone of Human adrenergic, alpha-1B-, receptor (ADRA1B), Myc-DDK-tagged
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 820.00
7 Weeks
Lenti ORF particles, ADRA1B (Myc-DDK tagged) - Human adrenergic, alpha-1B-, receptor (ADRA1B), 200ul, >10^7 TU/mL
Vector | pLenti-C-Myc-DDK-P2A-Puro |
Tag | Myc-DDK |
Mammalian Cell Selection | Puromycin |
USD 620.00
3 Weeks
Lenti ORF clone of Human adrenergic, alpha-1B-, receptor (ADRA1B), mGFP tagged
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 820.00
7 Weeks
Lenti ORF particles, ADRA1B (mGFP-tagged) - Human adrenergic, alpha-1B-, receptor (ADRA1B), 200ul, >10^7 TU/mL
Vector | pLenti-C-mGFP-P2A-Puro |
Tag | mGFP |
Mammalian Cell Selection | Puromycin |
USD 460.00
3 Weeks
ADRA1B (GFP-tagged) - Human adrenergic, alpha-1B-, receptor (ADRA1B)
Vector | pCMV6-AC-GFP |
Tag | TurboGFP |
Mammalian Cell Selection | Neomycin |
ADRA1B (untagged)-Human adrenergic, alpha-1B-, receptor (ADRA1B)
Vector | pCMV6-XL4 |
Tag | Tag Free |
Mammalian Cell Selection | None |
Goat Polyclonal Anti-ADRA1B Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat, Pig (Expected from sequence similarity: Dog, Cow) |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-ADRA1B Antibody: Peptide with sequence C-SSTKAKGHNPRSS, from the internal region of the protein sequence according to NP_000670.1. |
Rabbit Polyclonal Anti-alpha1B-Adrenoceptor (extracellular)
Applications | FC, IF, IHC, WB |
Reactivities | Human, Rat |
Conjugation | Unconjugated |
Immunogen | Peptide (C)KNANFTGPNQTSSNS, corresponding to amino acid residues 21-35 of human a1B-adrenoceptor . Extracellular, N-terminus. |
USD 450.00
2 Weeks
alpha 1b Adrenergic Receptor (ADRA1B) (Center) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Immunogen | KLH conjugated synthetic peptide between 276~306 amino acids from the Central region of human ADRA1B |
USD 620.00
3 Weeks
Lenti ORF clone of Human adrenergic, alpha-1B-, receptor (ADRA1B), mGFP tagged
Vector | pLenti-C-mGFP |
Tag | mGFP |
Mammalian Cell Selection | None |
Rabbit polyclonal anti-ADRA1B antibody
Applications | IF |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | The antiserum was produced against synthesized peptide derived from internal of human ADRA1B. |
USD 187.00
In Stock
ADRA1B HEK293T cell transient overexpression lysate (as WB positive control)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
USD 605.00
In Stock
Transient overexpression lysate of adrenergic, alpha-1B-, receptor (ADRA1B)
Tag | C-Myc/DDK |
Expression Host | HEK293T |
Applications | WB |
Alpha 1b / ADRA1B Rabbit Polyclonal (Cytoplasmic Domain) Antibody
Applications | IHC |
Reactivities | Gibbon, Bovine, Dog, Gorilla, Hamster, Horse, Human, Monkey, Mouse, Pig, Rat |
Conjugation | Unconjugated |
Immunogen | ADRA1B antibody was raised against synthetic 16 amino acid peptide from 3rd cytoplasmic domain of human ADRA1B. Percent identity with other species by BLAST analysis: Human, Gorilla, Gibbon, Monkey, Marmoset, Mouse, Rat, Bovine, Dog, Hamster, Elephant, Panda, Horse, Pig, Opossum (100%); Bat (94%); Turkey, Chicken (88%); Platypus (81%). |
Rabbit anti-ADRA1B polyclonal antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide conjugated to KLH |
Alpha 1b / ADRA1B Rabbit Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Bovine, Hamster, Human, Monkey, Mouse, Rat, Gorilla, Dog |
Conjugation | Unconjugated |
Immunogen | ADRA1B antibody was raised against synthetic 20 amino acid peptide from C-terminus of human ADRA1B. Percent identity with other species by BLAST analysis: Human, Gorilla, Monkey, Marmoset, Mouse, Rat, Hamster, Bovine, Dog (100%); Elephant (90%); Bat (85%); Opossum, Platypus (80%). |
Alpha 1b / ADRA1B Rabbit Polyclonal (C-Terminus) Antibody
Applications | IHC |
Reactivities | Gorilla, Human |
Immunogen | ADRA1B antibody was raised against synthetic 20 amino acid peptide from C-terminal cytoplasmic domain of human ADRA1B. Percent identity with other species by BLAST analysis: Human, Gorilla (100%); Monkey, Marmoset (95%); Mouse, Hamster, Elephant (85%). |
Rabbit Polyclonal Anti-ADRA1B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ADRA1B antibody: synthetic peptide directed towards the C terminal of human ADRA1B. Synthetic peptide located within the following region: YRPWTRGGSLERSQSRKDSLDDSGSCLSGSQRTLPSASPSPGYLGRGAPP |
Rabbit Polyclonal Anti-ADRA1B Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-ADRA1B antibody: synthetic peptide directed towards the N terminal of human ADRA1B. Synthetic peptide located within the following region: VWVLSTVISIGPLLGWKEPAPNDDKECGVTEEPFYALFSSLGSFYIPLAV |
Anti-ADRA1B Rabbit Polyclonal Antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 500-515 amino acids of Human Alpha-1B adrenergic receptor |
Anti-ADRA1B Rabbit Polyclonal Antibody
Applications | WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 500-515 amino acids of Human Alpha-1B adrenergic receptor |
Anti-ADRA1B rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide corresponding to a region derived from 506-520 amino acids of human adrenoceptor alpha 1B |
Transient overexpression of ADRA1B (NM_000679) in HEK293T cells paraffin embedded controls for ICC/IHC staining
Transient overexpression of ADRA1B (NM_000679) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack
Transient overexpression of ADRA1B (NM_000679) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack