Products

cDNA Clones (28)
Proteins (17)
Antibodies (2)
Jump to Filters
View as table Download
AHCYL2 (NM_015328) Human Tagged ORF Clone
RC204540

USD 570.00

In Stock

AHCYL2 (Myc-DDK-tagged)-Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
AHCYL2 (NM_001130720) Human Tagged ORF Clone
RC226018

USD 570.00

In Stock

AHCYL2 (Myc-DDK-tagged)-Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
AHCYL2 (NM_001130723) Human Tagged ORF Clone
RC225873

USD 470.00

In Stock

AHCYL2 (Myc-DDK-tagged)-Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
AHCYL2 (NM_001130722) Human Tagged ORF Clone
RC225876

USD 470.00

In Stock

AHCYL2 (Myc-DDK-tagged)-Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
AHCYL2 (NM_015328) Human Tagged ORF Clone
RC204540L3

USD 770.00

3 Weeks

Lenti ORF clone of Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
AHCYL2 (NM_015328) Human Tagged ORF Clone Lentiviral Particle
RC204540L3V

USD 970.00

6 Weeks

Lenti ORF particles, AHCYL2 (Myc-DDK tagged) - Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
AHCYL2 (NM_015328) Human Tagged ORF Clone
RC204540L4

USD 770.00

3 Weeks

Lenti ORF clone of Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AHCYL2 (NM_015328) Human Tagged ORF Clone Lentiviral Particle
RC204540L4V

USD 970.00

6 Weeks

Lenti ORF particles, AHCYL2 (mGFP-tagged) - Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AHCYL2 (NM_001130723) Human Tagged ORF Clone
RC225873L3

USD 670.00

3 Weeks

Lenti-ORF clone of AHCYL2 (Myc-DDK-tagged)-Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 4

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
AHCYL2 (NM_001130723) Human Tagged ORF Clone Lentiviral Particle
RC225873L3V

USD 870.00

6 Weeks

Lenti ORF particles, AHCYL2 (Myc-DDK-tagged)-Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
AHCYL2 (NM_001130723) Human Tagged ORF Clone
RC225873L4

USD 670.00

3 Weeks

Lenti-ORF clone of AHCYL2 (mGFP-tagged)-Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 4

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AHCYL2 (NM_001130723) Human Tagged ORF Clone Lentiviral Particle
RC225873L4V

USD 870.00

6 Weeks

Lenti ORF particles, AHCYL2 (mGFP-tagged)-Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AHCYL2 (NM_001130722) Human Tagged ORF Clone
RC225876L3

USD 670.00

3 Weeks

Lenti-ORF clone of AHCYL2 (Myc-DDK-tagged)-Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
AHCYL2 (NM_001130722) Human Tagged ORF Clone Lentiviral Particle
RC225876L3V

USD 870.00

6 Weeks

Lenti ORF particles, AHCYL2 (Myc-DDK-tagged)-Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
AHCYL2 (NM_001130722) Human Tagged ORF Clone
RC225876L4

USD 670.00

3 Weeks

Lenti-ORF clone of AHCYL2 (mGFP-tagged)-Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AHCYL2 (NM_001130722) Human Tagged ORF Clone Lentiviral Particle
RC225876L4V

USD 870.00

6 Weeks

Lenti ORF particles, AHCYL2 (mGFP-tagged)-Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AHCYL2 (NM_001130720) Human Tagged ORF Clone
RC226018L3

USD 770.00

3 Weeks

Lenti ORF clone of Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
AHCYL2 (NM_001130720) Human Tagged ORF Clone Lentiviral Particle
RC226018L3V

USD 970.00

6 Weeks

Lenti ORF particles, AHCYL2 (Myc-DDK tagged) - Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
AHCYL2 (NM_001130720) Human Tagged ORF Clone
RC226018L4

USD 770.00

3 Weeks

Lenti ORF clone of Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AHCYL2 (NM_001130720) Human Tagged ORF Clone Lentiviral Particle
RC226018L4V

USD 970.00

6 Weeks

Lenti ORF particles, AHCYL2 (mGFP-tagged) - Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AHCYL2 (NM_015328) Human Tagged ORF Clone
RG204540

USD 630.00

3 Weeks

AHCYL2 (GFP-tagged) - Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
AHCYL2 (NM_001130723) Human Tagged ORF Clone
RG225873

USD 520.00

3 Weeks

AHCYL2 (GFP-tagged) - Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
AHCYL2 (NM_001130722) Human Tagged ORF Clone
RG225876

USD 520.00

3 Weeks

AHCYL2 (GFP-tagged) - Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
AHCYL2 (NM_001130720) Human Tagged ORF Clone
RG226018

USD 630.00

3 Weeks

AHCYL2 (GFP-tagged) - Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
AHCYL2 Rabbit Polyclonal Antibody
TA308718

USD 415.00

5 Days

Rabbit Polyclonal antibody to AHCYL2 (adenosylhomocysteinase-like 2)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 298 and 578 of AHCYL2 (Uniprot ID#Q96HN2)
AHCYL2 (NM_015328) Human Untagged Clone
SC127568

USD 1,040.00

In Stock

AHCYL2 (untagged)-Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
AHCYL2 Rabbit Polyclonal Antibody
TA332189

USD 375.00

5 Days

Rabbit Polyclonal Anti-AHCYL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-AHCYL2 Antibody is: synthetic peptide directed towards the N-terminal region of Human AHCYL2. Synthetic peptide located within the following region: TDSYSSAASYTDSSDDETSPRDKQQKNSKGSSDFCVKNIKQAEFGRREIE
AHCYL2 (NM_015328) Human Over-expression Lysate
LC414625

USD 121.00

2 Weeks

AHCYL2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
AHCYL2 (NM_001130720) Human Over-expression Lysate
LC427264

USD 121.00

2 Weeks

AHCYL2 HEK293T cell transient overexpression lysate (as WB positive control)

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
AHCYL2 (NM_015328) Human Over-expression Lysate
LY414625

USD 396.00

5 Days

Transient overexpression lysate of adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 1

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
AHCYL2 (NM_001130720) Human Over-expression Lysate
LY427264

USD 396.00

5 Days

Transient overexpression lysate of adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 2

Tag C-Myc/DDK
Expression Host HEK293T
Applications WB
AHCYL2 (NM_001130720) Human Mass Spec Standard
PH326018

USD 2,055.00

3 Weeks

AHCYL2 MS Standard C13 and N15-labeled recombinant protein (NP_001124192)

Tag C-Myc/DDK
Expression Host HEK293
AHCYL2 (NM_001130723) Human Untagged Clone
SC326003

USD 850.00

4 Weeks

AHCYL2 (untagged)-Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 4

Vector pCMV6 series
Tag Tag Free
AHCYL2 (NM_001130722) Human Untagged Clone
SC326004

USD 870.00

4 Weeks

AHCYL2 (untagged)-Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 3

Vector pCMV6 series
Tag Tag Free
AHCYL2 (NM_001130720) Human Untagged Clone
SC326105

USD 1,040.00

3 Weeks

AHCYL2 (untagged)-Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 2

Vector pCMV6-Entry
Tag Tag Free
Mammalian Cell Selection Neomycin
AHCYL2 (NM_015328) ICC Control Block
TB404540

USD 1,220.00

4 Weeks

Transient overexpression of AHCYL2 (NM_015328) in HEK293T cells paraffin embedded controls for ICC/IHC staining

AHCYL2 (NM_001130723) ICC Control Block
TB425873

USD 1,120.00

4 Weeks

Transient overexpression of AHCYL2 (NM_001130723) in HEK293T cells paraffin embedded controls for ICC/IHC staining

AHCYL2 (NM_001130722) ICC Control Block
TB425876

USD 1,120.00

4 Weeks

Transient overexpression of AHCYL2 (NM_001130722) in HEK293T cells paraffin embedded controls for ICC/IHC staining

AHCYL2 (NM_001130720) ICC Control Block
TB426018

USD 1,220.00

4 Weeks

Transient overexpression of AHCYL2 (NM_001130720) in HEK293T cells paraffin embedded controls for ICC/IHC staining

AHCYL2 Cytosection
TS404540

USD 225.00

4 Weeks

Transient overexpression of AHCYL2 (NM_015328) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

AHCYL2 Cytosection
TS404540P5

USD 889.00

4 Weeks

Transient overexpression of AHCYL2 (NM_015328) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

AHCYL2 Cytosection
TS425873

USD 225.00

4 Weeks

Transient overexpression of AHCYL2 (NM_001130723) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

AHCYL2 Cytosection
TS425873P5

USD 889.00

4 Weeks

Transient overexpression of AHCYL2 (NM_001130723) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

AHCYL2 Cytosection
TS425876

USD 225.00

4 Weeks

Transient overexpression of AHCYL2 (NM_001130722) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

AHCYL2 Cytosection
TS425876P5

USD 889.00

4 Weeks

Transient overexpression of AHCYL2 (NM_001130722) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack

AHCYL2 Cytosection
TS426018

USD 225.00

4 Weeks

Transient overexpression of AHCYL2 (NM_001130720) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 5 slides per pack

AHCYL2 Cytosection
TS426018P5

USD 889.00

4 Weeks

Transient overexpression of AHCYL2 (NM_001130720) in HEK293T cells paraffin embedded 4 um sections, controls for ICC/IHC staining, 25 slides per pack