Products

cDNA Clones (49)
Proteins (18)
RNAi (8)
Gene Expression (7)
Antibodies (3)
Jump to Filters
View as table Download
AHCYL2 (NM_015328) Human Tagged ORF Clone
RC204540

USD 570.00

In Stock

AHCYL2 (Myc-DDK-tagged)-Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
AHCYL2 (NM_001130720) Human Tagged ORF Clone
RC226018

USD 570.00

In Stock

AHCYL2 (Myc-DDK-tagged)-Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
Ahcyl2 (NM_021414) Mouse Tagged ORF Clone
MR209418

USD 590.00

In Stock

Ahcyl2 (Myc-DDK-tagged) - Mouse S-adenosylhomocysteine hydrolase-like 2 (Ahcyl2), transcript variant 1

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
AHCYL2 (NM_001130723) Human Tagged ORF Clone
RC225873

USD 470.00

In Stock

AHCYL2 (Myc-DDK-tagged)-Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 4

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
AHCYL2 (NM_001130722) Human Tagged ORF Clone
RC225876

USD 470.00

In Stock

AHCYL2 (Myc-DDK-tagged)-Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
AHCYL2 Human Gene Knockout Kit (CRISPR)
KN404540

USD 1,290.00

2 Weeks

AHCYL2 - KN2.0, Human gene knockout kit via CRISPR, non-homology mediated.

Format 2 gRNA vectors, 1 linear donor
Donor DNA EF1a-GFP-P2A-Puro
KN404540 is the updated version of KN204540.
Ahcyl2 (NM_021414) Mouse Tagged ORF Clone
MG209418

USD 650.00

3 Weeks

Ahcyl2 (GFP-tagged) - Mouse RIKEN cDNA 4631427C17 gene (4631427C17Rik)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Ahcyl2 (NM_001171000) Mouse Tagged ORF Clone
MG216683

USD 700.00

3 Weeks

Ahcyl2 (GFP-tagged) - Mouse S-adenosylhomocysteine hydrolase-like 2 (Ahcyl2) transcript variant 2, (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Ahcyl2 (NM_001171001) Mouse Tagged ORF Clone
MG218169

USD 580.00

3 Weeks

Ahcyl2 (GFP-tagged) - Mouse S-adenosylhomocysteine hydrolase-like 2 (Ahcyl2) transcript variant 3, (10ug)

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Ahcyl2 (NM_021414) Mouse Tagged ORF Clone
MR209418L3

USD 790.00

3 Weeks

Lenti ORF clone of Ahcyl2 (Myc-DDK-tagged) - Mouse S-adenosylhomocysteine hydrolase-like 2 (Ahcyl2), transcript variant 1

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Ahcyl2 (NM_021414) Mouse Tagged ORF Clone Lentiviral Particle
MR209418L3V

USD 990.00

6 Weeks

Lenti ORF particles, Ahcyl2 (Myc-DDK-tagged) - Mouse S-adenosylhomocysteine hydrolase-like 2 (Ahcyl2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Ahcyl2 (NM_021414) Mouse Tagged ORF Clone
MR209418L4

USD 790.00

3 Weeks

Lenti ORF clone of Ahcyl2 (mGFP-tagged) - Mouse S-adenosylhomocysteine hydrolase-like 2 (Ahcyl2), transcript variant 1

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Ahcyl2 (NM_021414) Mouse Tagged ORF Clone Lentiviral Particle
MR209418L4V

USD 990.00

6 Weeks

Lenti ORF particles, Ahcyl2 (GFP-tagged) - Mouse S-adenosylhomocysteine hydrolase-like 2 (Ahcyl2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Ahcyl2 (NM_001171000) Mouse Tagged ORF Clone
MR216683

USD 640.00

2 Weeks

Ahcyl2 (Myc-DDK-tagged) - Mouse S-adenosylhomocysteine hydrolase-like 2 (Ahcyl2), transcript variant 2

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Ahcyl2 (NM_001171000) Mouse Tagged ORF Clone
MR216683L3

USD 840.00

4 Weeks

Lenti ORF clone of Ahcyl2 (Myc-DDK-tagged) - Mouse S-adenosylhomocysteine hydrolase-like 2 (Ahcyl2), transcript variant 2

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Ahcyl2 (NM_001171000) Mouse Tagged ORF Clone Lentiviral Particle
MR216683L3V

USD 1,040.00

7 Weeks

Lenti ORF particles, Ahcyl2 (Myc-DDK-tagged) - Mouse S-adenosylhomocysteine hydrolase-like 2 (Ahcyl2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Ahcyl2 (NM_001171000) Mouse Tagged ORF Clone
MR216683L4

USD 840.00

4 Weeks

Lenti ORF clone of Ahcyl2 (mGFP-tagged) - Mouse S-adenosylhomocysteine hydrolase-like 2 (Ahcyl2), transcript variant 2

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Ahcyl2 (NM_001171000) Mouse Tagged ORF Clone Lentiviral Particle
MR216683L4V

USD 1,040.00

7 Weeks

Lenti ORF particles, Ahcyl2 (GFP-tagged) - Mouse S-adenosylhomocysteine hydrolase-like 2 (Ahcyl2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Ahcyl2 (NM_001171001) Mouse Tagged ORF Clone
MR218169

USD 530.00

4 Weeks

Ahcyl2 (Myc-DDK-tagged) - Mouse S-adenosylhomocysteine hydrolase-like 2 (Ahcyl2), transcript variant 3

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
Ahcyl2 (NM_001171001) Mouse Tagged ORF Clone
MR218169L3

USD 730.00

8 Weeks

Lenti ORF clone of Ahcyl2 (Myc-DDK-tagged) - Mouse S-adenosylhomocysteine hydrolase-like 2 (Ahcyl2), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Ahcyl2 (NM_001171001) Mouse Tagged ORF Clone Lentiviral Particle
MR218169L3V

USD 930.00

11 Weeks

Lenti ORF particles, Ahcyl2 (Myc-DDK-tagged) - Mouse S-adenosylhomocysteine hydrolase-like 2 (Ahcyl2), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
Ahcyl2 (NM_001171001) Mouse Tagged ORF Clone
MR218169L4

USD 730.00

8 Weeks

Lenti ORF clone of Ahcyl2 (mGFP-tagged) - Mouse S-adenosylhomocysteine hydrolase-like 2 (Ahcyl2), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
Ahcyl2 (NM_001171001) Mouse Tagged ORF Clone Lentiviral Particle
MR218169L4V

USD 930.00

11 Weeks

Lenti ORF particles, Ahcyl2 (GFP-tagged) - Mouse S-adenosylhomocysteine hydrolase-like 2 (Ahcyl2), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AHCYL2 (NM_015328) Human Tagged ORF Clone
RC204540L3

USD 770.00

3 Weeks

Lenti ORF clone of Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 1, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
AHCYL2 (NM_015328) Human Tagged ORF Clone Lentiviral Particle
RC204540L3V

USD 970.00

6 Weeks

Lenti ORF particles, AHCYL2 (Myc-DDK tagged) - Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
AHCYL2 (NM_015328) Human Tagged ORF Clone
RC204540L4

USD 770.00

3 Weeks

Lenti ORF clone of Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 1, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AHCYL2 (NM_015328) Human Tagged ORF Clone Lentiviral Particle
RC204540L4V

USD 970.00

6 Weeks

Lenti ORF particles, AHCYL2 (mGFP-tagged) - Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 1, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AHCYL2 (NM_001130723) Human Tagged ORF Clone
RC225873L3

USD 670.00

3 Weeks

Lenti-ORF clone of AHCYL2 (Myc-DDK-tagged)-Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 4

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
AHCYL2 (NM_001130723) Human Tagged ORF Clone Lentiviral Particle
RC225873L3V

USD 870.00

6 Weeks

Lenti ORF particles, AHCYL2 (Myc-DDK-tagged)-Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
AHCYL2 (NM_001130723) Human Tagged ORF Clone
RC225873L4

USD 670.00

3 Weeks

Lenti-ORF clone of AHCYL2 (mGFP-tagged)-Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 4

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AHCYL2 (NM_001130723) Human Tagged ORF Clone Lentiviral Particle
RC225873L4V

USD 870.00

6 Weeks

Lenti ORF particles, AHCYL2 (mGFP-tagged)-Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 4, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AHCYL2 (NM_001130722) Human Tagged ORF Clone
RC225876L3

USD 670.00

3 Weeks

Lenti-ORF clone of AHCYL2 (Myc-DDK-tagged)-Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 3

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
AHCYL2 (NM_001130722) Human Tagged ORF Clone Lentiviral Particle
RC225876L3V

USD 870.00

6 Weeks

Lenti ORF particles, AHCYL2 (Myc-DDK-tagged)-Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
AHCYL2 (NM_001130722) Human Tagged ORF Clone
RC225876L4

USD 670.00

3 Weeks

Lenti-ORF clone of AHCYL2 (mGFP-tagged)-Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 3

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AHCYL2 (NM_001130722) Human Tagged ORF Clone Lentiviral Particle
RC225876L4V

USD 870.00

6 Weeks

Lenti ORF particles, AHCYL2 (mGFP-tagged)-Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 3, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AHCYL2 (NM_001130720) Human Tagged ORF Clone
RC226018L3

USD 770.00

3 Weeks

Lenti ORF clone of Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 2, Myc-DDK-tagged

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
AHCYL2 (NM_001130720) Human Tagged ORF Clone Lentiviral Particle
RC226018L3V

USD 970.00

6 Weeks

Lenti ORF particles, AHCYL2 (Myc-DDK tagged) - Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-Myc-DDK-P2A-Puro
Tag Myc-DDK
Mammalian Cell Selection Puromycin
  • LentiORF®
AHCYL2 (NM_001130720) Human Tagged ORF Clone
RC226018L4

USD 770.00

3 Weeks

Lenti ORF clone of Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 2, mGFP tagged

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AHCYL2 (NM_001130720) Human Tagged ORF Clone Lentiviral Particle
RC226018L4V

USD 970.00

6 Weeks

Lenti ORF particles, AHCYL2 (mGFP-tagged) - Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 2, 200ul, >10^7 TU/mL

Vector pLenti-C-mGFP-P2A-Puro
Tag mGFP
Mammalian Cell Selection Puromycin
  • LentiORF®
AHCYL2 (NM_015328) Human Tagged ORF Clone
RG204540

USD 630.00

3 Weeks

AHCYL2 (GFP-tagged) - Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 1

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
AHCYL2 (NM_001130723) Human Tagged ORF Clone
RG225873

USD 520.00

3 Weeks

AHCYL2 (GFP-tagged) - Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 4

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
AHCYL2 (NM_001130722) Human Tagged ORF Clone
RG225876

USD 520.00

3 Weeks

AHCYL2 (GFP-tagged) - Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 3

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
AHCYL2 (NM_001130720) Human Tagged ORF Clone
RG226018

USD 630.00

3 Weeks

AHCYL2 (GFP-tagged) - Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 2

Vector pCMV6-AC-GFP
Tag TurboGFP
Mammalian Cell Selection Neomycin
  • TrueORF®
Ahcyl2 (NM_001173510) Rat Tagged ORF Clone
RR216997

USD 630.00

5 Weeks

Ahcyl2 (myc-DDK-tagged) - Rat adenosylhomocysteinase-like 2 (Ahcyl2)

Vector pCMV6-Entry
Tag Myc-DDK
Mammalian Cell Selection Neomycin
  • TrueORF®
AHCYL2 Human siRNA Oligo Duplex (Locus ID 23382)
SR308232

USD 430.00

In Stock

AHCYL2 (Human) - 3 unique 27mer siRNA duplexes - 2 nmol each

Purity HPLC purified
Number of Transfections Approximately 330 transfections/2nmol in 24-well plate under optimized conditions (final conc. 10 nM).

Special offer: Get $100/€100 off this product. Use code: SR100

AHCYL2 Rabbit Polyclonal Antibody
TA308718

USD 415.00

5 Days

Rabbit Polyclonal antibody to AHCYL2 (adenosylhomocysteinase-like 2)

Applications IF, IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 298 and 578 of AHCYL2 (Uniprot ID#Q96HN2)
Ahcyl2 (NM_021414) Mouse Untagged Clone
MC202430

USD 210.00

In Stock

Ahcyl2 (untagged) - Mouse S-adenosylhomocysteine hydrolase-like 2 (Ahcyl2), transcript variant 1, (10ug)

Vector PCMV6-Kan/Neo
Tag Tag Free
Mammalian Cell Selection Neomycin
AHCYL2 (NM_015328) Human Untagged Clone
SC127568

USD 1,040.00

In Stock

AHCYL2 (untagged)-Human adenosylhomocysteinase-like 2 (AHCYL2), transcript variant 1

Vector pCMV6-XL4
Tag Tag Free
Mammalian Cell Selection None
AHCYL2 Rabbit Polyclonal Antibody
TA332189

USD 375.00

5 Days

Rabbit Polyclonal Anti-AHCYL2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-AHCYL2 Antibody is: synthetic peptide directed towards the N-terminal region of Human AHCYL2. Synthetic peptide located within the following region: TDSYSSAASYTDSSDDETSPRDKQQKNSKGSSDFCVKNIKQAEFGRREIE
Human AHCYL2 activation kit by CRISPRa
GA108265

USD 1,290.00

2 Weeks

AHCYL2 CRISPRa kit - CRISPR gene activation of human adenosylhomocysteinase like 2

Format 3gRNAs, 1 scramble ctrl and 1 enhancer vector